£€0€ €0€ €0€ €í#¡€0€ €2Z6S£€0€¢€0€ €Protein Data Bank¡€ €¡€0€ €ס€ ¢€ ¢€¡€0€ €PDB¡€¡€2Z6S£€¡€0€ €ס€¢€¤€¡€0€ €0€ € €0€0€ €¡€0€ €Unno£€M.Unno¤€M.0€ €¡€0€ €Kusama£€S.Kusama¤€S.0€ €¡€0€ €Chen£€H.Chen¤€H.0€ €¡€0€ €Shaik£€S.Shaik¤€S.0€ €¡€0€ € Ikeda-Saito£€ M.Ikeda-Saito¤€M.¡€0€ €¡€0€ €ס€¢€¤€«€1€¤€0€ €1€ €fStructural Characterization of the Fleeting Ferric Peroxo Species in Myoglobin: Experiment and Theory.¡€0€ € €0€0€ €¡€0€ €Unno£€M.Unno¤€M.0€ €¡€0€ €Chen£€H.Chen¤€H.0€ €¡€0€ €Kusama£€S.Kusama¤€S.0€ €¡€0€ €Shaik£€S.Shaik¤€S.0€ €¡€0€ € Ikeda-Saito£€ M.Ikeda-Saito¤€M.¡€ €‚lInstitute of Multidisciplinary Research for Advanced Materials, Tohoku University, Sendai 980-8577, Japan, RIKEN SPring-8 Center, Harima Institute, Sayo, Hyogo 679-5148, Japan, and Department of Organic Chemistry and the Lise Meitner-Minerva Center for Computational Quantum Chemistry, The Hebrew University of Jerusalem, Givat Ram Campus, 91904 Jerusalem, Israel.¢€ €0€ €1€¤€J. Am. Chem. Soc.¥€ J Am Chem Soc§€ 0002-7863 €(Journal of the American Chemical Society¡€0€ €¡€0€ €ס€ ¢€¡€129¢€44£€ 13394-13395¨€ENG¬€­€1€0€ € ¡€¡€0€ €ס€ ¢€ 0€ €¡€¡€0€ €ס€ ¢€ ¤€ ¥€0€ € ¡€¡€0€ €ס€ ¢€ ¤€ ¥€£€1€¢€10.1021/ja076108x €–ɬ€–É¢€0€ €0€ €NCrystal Structure Of The Oxy Myoglobin Free From X-Ray- Induced Photoreduction¡€Oxygen Binding¢€NMol_id: 1; Organism_scientific: Physeter Catodon; Organism_common: Sperm Whale£€ùCrystal Structure Of The Oxy Myoglobin Free From X-Ray- Induced Photoreduction Heme, Oxygen Transport, Microspectrophotometer, X-Ray- Induced-Photoreduction, Iron, Metal-Binding, Muscle Protein Oxygen Binding Mol_id: 1; Molecule: Myoglobin; Chain: A§€ÿ¡€0€0€ €¡€0€ €A£€SEQRES¨€¥€0€¢€0€ €Physeter catodon¡€ sperm whale£€1€0€ €taxon¡€ €&¤€1€Physeter macrocephalus¥€0€ € €0€ €Physeter¡€catodon£€¢Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Physeteridae; Physeter¤€¥€¦€MAM¢€«€ ÆÌ£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€<0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €€¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‚¡€ 130 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ƒ¡€ 131 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €„¡€ 132 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €…¡€ 133 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €†¡€ 134 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‡¡€ 135 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ˆ¡€ 136 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‰¡€ 137 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Š¡€ 138 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €‹¡€ 139 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Œ¡€ 140 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 141 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ž¡€ 142 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 143 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 144 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‘¡€ 145 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €’¡€ 146 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €“¡€ 147 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €”¡€ 148 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €•¡€ 149 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €–¡€ 150 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €—¡€ 151 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €˜¡€ 152 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €™¡€ ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€ 0€ €0€ €¡€"¢€¡€0€ €¡€#¢€0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€ 0€ €0€ €¡€&¢€¡€0€ €¡€'¢€ 0€ €0€ €¡€'¢€¡€0€ €¡€(¢€ 0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€ 0€ €0€ €¡€-¢€¡€0€ €¡€.¢€0€ €0€ €¡€.¢€¡€0€ €¡€/¢€ 0€ €0€ €¡€/¢€¡€0€ €¡€0¢€ 0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€ 0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€ 0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€ 0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€ 0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€ 0€ €0€ €¡€E¢€¡€0€ €¡€F¢€ 0€ €0€ €¡€F¢€¡€0€ €¡€G¢€0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€0€ €0€ €¡€I¢€¡€0€ €¡€J¢€0€ €0€ €¡€J¢€¡€0€ €¡€K¢€ 0€ €0€ €¡€K¢€¡€0€ €¡€L¢€ 0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€ 0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€ 0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€ 0€ €0€ €¡€S¢€¡€0€ €¡€T¢€0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€ 0€ €0€ €¡€V¢€¡€0€ €¡€W¢€ 0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€ 0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€ 0€ €0€ €¡€e¢€¡€0€ €¡€f¢€ 0€ €0€ €¡€f¢€¡€0€ €¡€g¢€0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€ 0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€0€ €0€ €¡€l¢€¡€0€ €¡€m¢€ 0€ €0€ €¡€m¢€¡€0€ €¡€n¢€0€ €0€ €¡€n¢€¡€0€ €¡€o¢€ 0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€ 0€ €0€ €¡€q¢€¡€0€ €¡€r¢€ 0€ €0€ €¡€r¢€¡€0€ €¡€s¢€ 0€ €0€ €¡€s¢€¡€0€ €¡€t¢€ 0€ €0€ €¡€t¢€¡€0€ €¡€u¢€0€ €0€ €¡€u¢€¡€0€ €¡€v¢€ 0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€‚¢€0€ €0€ €¡€‚¢€¡€0€ €¡€ƒ¢€0€ €0€ €¡€ƒ¢€¡€0€ €¡€„¢€0€ €0€ €¡€„¢€¡€0€ €¡€…¢€ 0€ €0€ €¡€…¢€¡€0€ €¡€†¢€0€ €0€ €¡€†¢€¡€0€ €¡€‡¢€ 0€ €0€ €¡€‡¢€¡€0€ €¡€ˆ¢€ 0€ €0€ €¡€ˆ¢€¡€0€ €¡€‰¢€ 0€ €0€ €¡€‰¢€¡€0€ €¡€Š¢€0€ €0€ €¡€Š¢€¡€0€ €¡€‹¢€ 0€ €0€ €¡€‹¢€¡€0€ €¡€Œ¢€ 0€ €0€ €¡€Œ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€Ž¢€ 0€ €0€ €¡€Ž¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€‘¢€ 0€ €0€ €¡€‘¢€¡€0€ €¡€’¢€0€ €0€ €¡€’¢€¡€0€ €¡€“¢€ 0€ €0€ €¡€“¢€¡€0€ €¡€”¢€ 0€ €0€ €¡€”¢€¡€0€ €¡€•¢€ 0€ €0€ €¡€•¢€¡€0€ €¡€–¢€0€ €0€ €¡€–¢€¡€0€ €¡€—¢€0€ €0€ €¡€—¢€¡€0€ €¡€˜¢€0€ €¡€0€ €1¨€£€0€0€ €¡€ 301 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 302 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 201 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 401 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 402 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 403 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 404 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 405 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 406 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 407 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 408 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 409 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 410 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 411 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 412 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 413 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 414 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 415 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 416 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 417 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 418 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 419 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 420 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 421 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 422 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 423 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 424 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 425 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 426 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 427 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 428 ¢€ €0€ €!¡€0€ €1¨€£€0€0€ €¡€ 429 ¢€ €0€ €"¡€0€ €1¨€£€0€0€ €¡€ 430 ¢€ €0€ €#¡€0€ €1¨€£€0€0€ €¡€ 431 ¢€ €0€ €$¡€0€ €1¨€£€0€0€ €¡€ 432 ¢€ €0€ €%¡€0€ €1¨€£€0€0€ €¡€ 433 ¢€ €0€ €&¡€0€ €1¨€£€0€0€ €¡€ 434 ¢€ €0€ €'¡€0€ €1¨€£€0€0€ €¡€ 435 ¢€ €0€ €(¡€0€ €1¨€£€0€0€ €¡€ 436 ¢€ €0€ €)¡€0€ €1¨€£€0€0€ €¡€ 437 ¢€ €0€ €*¡€0€ €1¨€£€0€0€ €¡€ 438 ¢€ €0€ €+¡€0€ €1¨€£€0€0€ €¡€ 439 ¢€ €0€ €,¡€0€ €1¨€£€0€0€ €¡€ 440 ¢€ €0€ €-¡€0€ €1¨€£€0€0€ €¡€ 441 ¢€ €0€ €.¡€0€ €1¨€£€0€0€ €¡€ 442 ¢€ €0€ €/¡€0€ €1¨€£€0€0€ €¡€ 443 ¢€ €0€ €0¡€0€ €1¨€£€0€0€ €¡€ 444 ¢€ €0€ €1¡€0€ €1¨€£€0€0€ €¡€ 445 ¢€ €0€ €2¡€0€ €1¨€£€0€0€ €¡€ 446 ¢€ €0€ €3¡€0€ €1¨€£€0€0€ €¡€ 447 ¢€ €0€ €4¡€0€ €1¨€£€0€0€ €¡€ 448 ¢€ €0€ €5¡€0€ €1¨€£€0€0€ €¡€ 449 ¢€ €0€ €6¡€0€ €1¨€£€0€0€ €¡€ 450 ¢€ €0€ €7¡€0€ €1¨€£€0€0€ €¡€ 451 ¢€ €0€ €8¡€0€ €1¨€£€0€0€ €¡€ 452 ¢€ €0€ €9¡€0€ €1¨€£€0€0€ €¡€ 453 ¢€ €0€ €:¡€0€ €1¨€£€0€0€ €¡€ 454 ¢€ €0€ €;¡€0€ €1¨€£€0€0€ €¡€ 455 ¢€ €0€ €<¡€0€ €1¨€£€0€0€ €¡€ 456 ¢€ €0€ €=¡€0€ €1¨€£€0€0€ €¡€ 457 ¢€ €0€ €>¡€0€ €1¨€£€0€0€ €¡€ 458 ¢€ €0€ €?¡€0€ €1¨€£€0€0€ €¡€ 459 ¢€ €0€ €@¡€0€ €1¨€£€0€0€ €¡€ 460 ¢€ €0€ €A¡€0€ €1¨€£€0€0€ €¡€ 461 ¢€ €0€ €B¡€0€ €1¨€£€0€0€ €¡€ 462 ¢€ €0€ €C¡€0€ €1¨€£€0€0€ €¡€ 463 ¢€ €0€ €D¡€0€ €1¨€£€0€0€ €¡€ 464 ¢€ €0€ €E¡€0€ €1¨€£€0€0€ €¡€ 465 ¢€ €0€ €F¡€0€ €1¨€£€0€0€ €¡€ 466 ¢€ €0€ €G¡€0€ €1¨€£€0€0€ €¡€ 467 ¢€ €0€ €H¡€0€ €1¨€£€0€0€ €¡€ 468 ¢€ €0€ €I¡€0€ €1¨€£€0€0€ €¡€ 469 ¢€ €0€ €J¡€0€ €1¨€£€0€0€ €¡€ 470 ¢€ €0€ €K¡€0€ €1¨€£€0€0€ €¡€ 471 ¢€ €0€ €L¡€0€ €1¨€£€0€0€ €¡€ 472 ¢€ €0€ €M¡€0€ €1¨€£€0€0€ €¡€ 473 ¢€ €0€ €N¡€0€ €1¨€£€0€0€ €¡€ 474 ¢€ €0€ €O¡€0€ €1¨€£€0€0€ €¡€ 475 ¢€ €0€ €P¡€0€ €1¨€£€0€0€ €¡€ 476 ¢€ €0€ €Q¡€0€ €1¨€£€0€0€ €¡€ 477 ¢€ €0€ €R¡€0€ €1¨€£€0€0€ €¡€ 478 ¢€ €0€ €S¡€0€ €1¨€£€0€0€ €¡€ 479 ¢€ €0€ €T¡€0€ €1¨€£€0€0€ €¡€ 480 ¢€ €0€ €U¡€0€ €1¨€£€0€0€ €¡€ 481 ¢€ €0€ €V¡€0€ €1¨€£€0€0€ €¡€ 482 ¢€ €0€ €W¡€0€ €1¨€£€0€0€ €¡€ 483 ¢€ €0€ €X¡€0€ €1¨€£€0€0€ €¡€ 484 ¢€ €0€ €Y¡€0€ €1¨€£€0€0€ €¡€ 485 ¢€ €0€ €Z¡€0€ €1¨€£€0€0€ €¡€ 486 ¢€ €0€ €[¡€0€ €1¨€£€0€0€ €¡€ 487 ¢€ €0€ €\¡€0€ €1¨€£€0€0€ €¡€ 488 ¢€ €0€ €]¡€0€ €1¨€£€0€0€ €¡€ 489 ¢€ €0€ €^¡€0€ €1¨€£€0€0€ €¡€ 490 ¢€ €0€ €_¡€0€ €1¨€£€0€0€ €¡€ 491 ¢€ €0€ €`¡€0€ €1¨€£€0€0€ €¡€ 492 ¢€ €0€ €a¡€0€ €1¨€£€0€0€ €¡€ 493 ¢€ €0€ €b¡€0€ €1¨€£€0€0€ €¡€ 494 ¢€ €0€ €c¡€0€ €1¨€£€0€0€ €¡€ 495 ¢€ €0€ €d¡€0€ €1¨€£€0€0€ €¡€ 496 ¢€ €0€ €e¡€0€ €1¨€£€0€0€ €¡€ 497 ¢€ €0€ €f¡€0€ €1¨€£€0€0€ €¡€ 498 ¢€ €0€ €g¡€0€ €1¨€£€0€0€ €¡€ 499 ¢€ €0€ €h¡€0€ €1¨€£€0€0€ €¡€ 500 ¢€ €0€ €i¡€0€ €1¨€£€0€0€ €¡€ 501 ¢€ €0€ €j¡€0€ €1¨€£€0€0€ €¡€ 502 ¢€ €0€ €k¡€0€ €1¨€£€0€0€ €¡€ 503 ¢€ €0€ €l¡€0€ €1¨€£€0€0€ €¡€ 504 ¢€ €0€ €m¡€0€ €1¨€£€0€0€ €¡€ 505 ¢€ €0€ €n¡€0€ €1¨€£€0€0€ €¡€ 506 ¢€ €0€ €o¡€0€ €1¨€£€0€0€ €¡€ 507 ¢€ €0€ €p¡€0€ €1¨€£€0€0€ €¡€ 508 ¢€ €0€ €q¡€0€ €1¨€£€0€0€ €¡€ 509 ¢€ €0€ €r¡€0€ €1¨€£€0€0€ €¡€ 510 ¢€ €0€ €s¡€0€ €1¨€£€0€0€ €¡€ 511 ¢€ €0€ €t¡€0€ €1¨€£€0€0€ €¡€ 512 ¢€ €0€ €u¡€0€ €1¨€£€0€0€ €¡€ 513 ¢€ €0€ €v¡€0€ €1¨€£€0€0€ €¡€ 514 ¢€ €0€ €w¡€0€ €1¨€£€0€0€ €¡€ 515 ¢€ €0€ €x¡€0€ €1¨€£€0€0€ €¡€ 516 ¢€ €0€ €y¡€0€ €1¨€£€0€0€ €¡€ 517 ¢€ €0€ €z¡€0€ €1¨€£€0€0€ €¡€ 518 ¢€ €0€ €{¡€0€ €1¨€£€0€0€ €¡€ 519 ¢€ €0€ €|¡€0€ €1¨€£€0€0€ €¡€ 520 ¢€ €0€ €}¡€0€ €1¨€£€0€0€ €¡€ 521 ¢€ €0€ €~¡€0€ €1¨€£€0€0€ €¡€ 522 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 523 ¢€ €0€ €€¡€0€ €1¨€£€0€0€ €¡€ 524 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 525 ¢€ €0€ €‚¡€0€ €1¨€£€0€0€ €¡€ 526 ¢€ €0€ €ƒ¡€0€ €1¨€£€0€0€ €¡€ 527 ¢€ €0€ €„¡€0€ €1¨€£€0€0€ €¡€ 528 ¢€ €0€ €…¡€0€ €1¨€£€0€0€ €¡€ 529 ¢€ €0€ €†¡€0€ €1¨€£€0€0€ €¡€ 530 ¢€ €0€ €‡¡€0€ €1¨€£€0€0€ €¡€ 531 ¢€ €0€ €ˆ¡€0€ €1¨€£€0€0€ €¡€ 532 ¢€ €0€ €‰¡€0€ €1¨€£€0€0€ €¡€ 533 ¢€ €0€ €Š¡€0€ €1¨€£€0€0€ €¡€ 534 ¢€ €0€ €‹¡€0€ €1¨€£€0€0€ €¡€ 535 ¢€ €0€ €Œ¡€0€ €1¨€£€0€0€ €¡€ 536 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 537 ¢€ €0€ €Ž¡€0€ €1¨€£€0€0€ €¡€ 538 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 539 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 540 ¢€ €0€ €‘¡€0€ €1¨€£€0€0€ €¡€ 541 ¢€ €0€ €’¡€0€ €1¨€£€0€0€ €¡€ 542 ¢€ €0€ €“¡€0€ €1¨€£€0€0€ €¡€ 543 ¢€ €0€ €”¡€0€ €1¨€£€0€0€ €¡€ 544 ¢€ €0€ €•¡€0€ €1¨€£€0€0€ €¡€ 545 ¢€ €0€ €–¡€0€ €1¨€£€0€0€ €¡€ 546 ¢€ €0€ €—¡€0€ €1¨€£€0€0€ €¡€ 547 ¢€ €0€ €˜¡€0€ €1¨€£€0€0€ €¡€ 548 ¢€ €0€ €™¡€0€ €1¨€£€0€0€ €¡€ 549 ¢€ €0€ €š¡€0€ €1¨€£€0€0€ €¡€ 550 ¢€ €0€ €›¡€0€ €1¨€£€0€0€ €¡€ 551 ¢€ €0€ €œ¡€0€ €1¨€£€0€0€ €¡€ 552 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 553 ¢€ €0€ €ž¡€0€ €1¨€£€0€0€ €¡€ 554 ¢€ €0€ €Ÿ¡€0€ €1¨€£€0€0€ €¡€ 555 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 556 ¢€ €0€ €¡¡€0€ €1¨€£€0€0€ €¡€ 557 ¢€ €0€ €¢¡€0€ €1¨€£€0€0€ €¡€ 558 ¢€ €0€ €£¡€0€ €1¨€£€0€0€ €¡€ 559 ¢€ €0€ €¤¡€0€ €1¨€£€0€0€ €¡€ 560 ¢€ €0€ €¥¡€0€ €1¨€£€0€0€ €¡€ 561 ¢€ €0€ €¦¡€0€ €1¨€£€0€0€ €¡€ 562 ¢€ €0€ €§¡€0€ €1¨€£€0€0€ €¡€ 563 ¢€ €0€ €¨¡€0€ €1¨€£€0€0€ €¡€ 564 ¢€ €0€ €©¡€0€ €1¨€£€0€0€ €¡€ 565 ¢€ €0€ €ª¡€0€ €1¨€£€0€0€ €¡€ 566 ¢€ €0€ €«¡€0€ €1¨€£€0€0€ €¡€ 567 ¢€ €0€ €¬¡€0€ €1¨€£€0€0€ €¡€ 568 ¢€ €0€ €­¡€0€ €1¨€£€0€0€ €¡€ 569 ¢€ €0€ €®¡€0€ €1¨€£€0€0€ €¡€ 570 ¢€ €0€ €¯¡€0€ €1¨€£€0€0€ €¡€ 571 ¢€ €0€ €°¡€0€ €1¨€£€0€0€ €¡€ 572 ¢€ €0€ €±¡€0€ €1¨€£€0€0€ €¡€ 573 ¢€ €0€ €²¡€0€ €1¨€£€0€0€ €¡€ 574 ¢€ €0€ €³¡€0€ €1¨€£€0€0€ €¡€ 575 ¢€ €0€ €´¡€0€ €1¨€£€0€0€ €¡€ 576 ¢€ €0€ €µ¡€0€ €1¨€£€0€0€ €¡€ 577 ¢€ €0€ €¶¡€0€ €1¨€£€0€0€ €¡€ 578 ¢€ €¢€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€]¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €SO4£€¢€ÿ£€0€X¤€0€0€ €¡€ S ¢€0€ S £€ 0€ €¡€ O1 ¢€0€ O1 £€ 0€ €¡€ O2 ¢€0€ O2 £€ 0€ €¡€ O3 ¢€0€ O3 £€ 0€ €¡€ O4 ¢€0€ O4 £€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€0€ €HEM£€¢€ÿ£€0€X¤€0€0€ €¡€FE ¢€0€FE £€ 0€ €¡€ CHA¢€0€ CHA£€ 0€ €¡€ CHB¢€0€ CHB£€ 0€ €¡€ CHC¢€0€ CHC£€ 0€ €¡€ CHD¢€0€ CHD£€ 0€ €¡€ NA ¢€0€ NA £€ 0€ €¡€ C1A¢€0€ C1A£€ 0€ €¡€ C2A¢€0€ C2A£€ 0€ € ¡€ C3A¢€0€ C3A£€ 0€ € ¡€ C4A¢€0€ C4A£€ 0€ € ¡€ CMA¢€0€ CMA£€ 0€ € ¡€ CAA¢€0€ CAA£€ 0€ € ¡€ CBA¢€0€ CBA£€ 0€ €¡€ CGA¢€0€ CGA£€ 0€ €¡€ O1A¢€0€ O1A£€ 0€ €¡€ O2A¢€0€ O2A£€ 0€ €¡€ NB ¢€0€ NB £€ 0€ €¡€ C1B¢€0€ C1B£€ 0€ €¡€ C2B¢€0€ C2B£€ 0€ €¡€ C3B¢€0€ C3B£€ 0€ €¡€ C4B¢€0€ C4B£€ 0€ €¡€ CMB¢€0€ CMB£€ 0€ €¡€ CAB¢€0€ CAB£€ 0€ €¡€ CBB¢€0€ CBB£€ 0€ €¡€ NC ¢€0€ NC £€ 0€ €¡€ C1C¢€0€ C1C£€ 0€ €¡€ C2C¢€0€ C2C£€ 0€ €¡€ C3C¢€0€ C3C£€ 0€ €¡€ C4C¢€0€ C4C£€ 0€ €¡€ CMC¢€0€ CMC£€ 0€ €¡€ CAC¢€0€ CAC£€ 0€ € ¡€ CBC¢€0€ CBC£€ 0€ €!¡€ ND ¢€0€ ND £€ 0€ €"¡€ C1D¢€0€ C1D£€ 0€ €#¡€ C2D¢€0€ C2D£€ 0€ €$¡€ C3D¢€0€ C3D£€ 0€ €%¡€ C4D¢€0€ C4D£€ 0€ €&¡€ CMD¢€0€ CMD£€ 0€ €'¡€ CAD¢€0€ CAD£€ 0€ €(¡€ CBD¢€0€ CBD£€ 0€ €)¡€ CGD¢€0€ CGD£€ 0€ €*¡€ O1D¢€0€ O1D£€ 0€ €+¡€ O2D¢€0€ O2D£€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€!¢€ÿ0€ €¡€¢€ÿ0€ €¡€%¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€"¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €!¡€"¢€ÿ0€ €!¡€%¢€ÿ0€ €"¡€#¢€ÿ0€ €#¡€$¢€ÿ0€ €#¡€&¢€ÿ0€ €$¡€%¢€ÿ0€ €$¡€'¢€ÿ0€ €'¡€(¢€ÿ0€ €(¡€)¢€ÿ0€ €)¡€*¢€ÿ0€ €)¡€+¢€ÿ0€ €¡€0€ €OXY£€¢€ÿ£€0€X¤€0€0€ €¡€ O1 ¢€0€ O1 £€ 0€ €¡€ O2 ¢€0€ O2 £€ ¥€0€0€ €¡€¢€ÿ0€ €¡€0€ €HOH£€¢€ÿ£€0€X¤€0€0€ €¡€ O ¢€0€ O £€ ¥€0€£€0€0€ €¡€0€ €PDB secondary structure¢€0€0€ €¡€ 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€ 2¢€¤€ €¡€¡€0€0€ €¡€¢€$0€ €¡€ 3¢€¤€ €¡€¡€0€0€ €¡€$¢€)0€ €¡€ 4¢€¤€ €¡€¡€0€0€ €¡€3¢€90€ €¡€ 5¢€¤€ €¡€¡€0€0€ €¡€:¢€N0€ €¡€ 6¢€¤€ €¡€¡€0€0€ €¡€R¢€`0€ €¡€ 7¢€¤€ €¡€¡€0€0€ €¡€d¢€w0€ €¡€ 8¢€¤€ €¡€¡€0€0€ €¡€x¢€{0€ € ¡€ 9¢€¤€ €¡€¡€0€0€ €¡€|¢€•0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€helix 2¢€¤€ €¡€¡€0€0€ €¡€¢€#0€ €¡€helix 3¢€¤€ €¡€¡€0€0€ €¡€;¢€L0€ €¡€helix 4¢€¤€ €¡€¡€0€0€ €¡€W¢€_0€ €¡€helix 5¢€¤€ €¡€¡€0€0€ €¡€f¢€v0€ €¡€helix 6¢€¤€ €¡€¡€0€0€ €¡€}¢€•¤€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry 2Z6S with a vector model attached¡€Resolution: 1.25¢€X-Ray Diffraction£€,NOV 13 7 Typographical~NOV 6 7 Initial Entry£€0€ € ¡€ ¢€ ¤€0€0€ €¢€ € €0€ €›¡€0€ €›¡€0€      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~€‚ƒ„…†‡ˆ‰Š‹ŒŽ‘’“”•–—˜™š›œžŸ ¡¢£¤¥¦§¨©ª«¬­®¯°±²³´µ¶¢€0€                                                !!!!!!!!!!!"""""""""######$$$$$$$$$$%%%%%%%&&&&&&&&&'''''''(((((((()))))))))*********+++++++++++,,,,,,,,-----------.........../////////0000000000111111112222222223333333444444444555556666666667777777788888888899999::::::;;;;;;;;;<<<<<<<<========>>>>>>>>>?????????@@@@@@@@@@AAAABBBBBBBCCCCCCCDDDDDDDEEEEEEEEFFFFFFFGGGGGHHHHHHHHIIIIJJJJJKKKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNNNOOOOOOOOOPPPPQQQQQQQQQQRRRRRRRRRRSSSSSSSSSTTTTTUUUUUUUUUVVVVVVVVWWWWWWWWWXXXXXXXYYYYYYYYZZZZZ[[[[[[[[[\\\\\\]]]]]]]]]]^^^^^_______`````````aaaaaaaaaabbbbbccccccccdddddddeeeeeeeefffffffffgggggggggggghhhhhhhhiiiiiiiiijjjjjjjjjjjkkkkkkkkllllllmmmmmmmmmnnnnnooooooooppppppppqqqqqqqqqqrrrrrrrssssssssttttttttttuuuuuuvvvvvvvvvvvwwwwwwwwwwxxxxxxxyyyyzzzzzzzz{{{{{{{{{{{||||}}}}}~~~~~~~~€€€€€€€€€‚‚‚‚‚ƒƒƒƒƒƒƒƒ„„„„„„„„………………………†††††‡‡‡‡‡‡‡‡ˆˆˆˆˆˆˆˆˆ‰‰‰‰‰‰‰‰ŠŠŠŠŠŠŠŠŠŠŠ‹‹‹‹‹‹‹‹‹‹‹ŒŒŒŒŒŒŒŒŒŽŽŽŽŽŽŽŽ‘‘‘‘‘‘‘‘‘’’’’’’’’’’’’“““““““““”””””””””••••••••––––————————————˜˜˜˜£€0€                                                                                                                                                                                                                                                                                                         !"#$%&'()*+¢€0€ €è¡€0€É=Äê¹ÁsÀƒ»?ÁLÂ)Àº ·<ÁÆŸÊËÆŸ¸q²å°–³q²³§«^¨Ñª(« ¢î ó¡t¢k ßª9«»±=²M´Äº&ºZ¼ù½¤¾ÑÁ)À{Ãç··tµ·´[·GµÅ¼)¹v½k¿ÁåÄÅK±®Û²ì³Bª"¥Ò Íœý Ô¶º1¾>¿÷¼Ì¹}¼C¸u¿ÑÆÁaÃìĨÇuÇ®¼º^¸·¸µñ·Ê³#»Ç·¶¶s»'ºÔ´b²É®µ*­³±Ó¿«ÄQÅÛÇÃÈãËJÌîÅ4Æ—ÃzÅ’Æ-ÉkÇuÏ˰ÐRÓÕ„Ø.ÙK¾»~½±¼óµÙÀAÃÇÑÉÄÐÀœ¼©¸€´ºÊ‚ÏÍ“ÐzÑdÕ„Ó•ÈñÇuÅùÅPÃ?żÂ_į½”ÅäÅPÊ\ÊNÞÎÝÓÞׄÛlÖMÛvÝ8Þ-ÖÙÞÂâ_Ö§Ú$Ñ7ß‹äåèAìêäúæ5éjêÿïsçLè­ìÝðSãÖàܘßÙ§ÚùìRð õ˜ù9ö@ûPý|õû7úøÒôôüFú`ü!ýª øö^øªò ú‚û—•éöÛòoø-í3ï ÑÖtŠ ‚y  Í   ” ½S*Ç šM ó  pf+˜ FC¦ <(p s%"KHH——Þê!ñ"é'f·É "=Ï"=$ÛÛ!ê#Ú&%#Åûñ™õ*Ø--Á-õ2v1`...Q)t)å/*»*Î,) % s ä÷‡ÎÉ#c#Þ&æ%Ð&'º"È*Š*». +,-,27Q9f8†<&#L ºx!2#¡%—&x çN"D$ˆTÓ’y  ›#$&^$K'o&¢)Ž,‰(ÑAÀX,×9 à ½¨üñ%B&Fœ-«“É ¹ O(´-x1 4œ0<1È3ô5 3À0-31Ã4›1ù,¦(Y*Ó$I%ž-n+ð/F/& "l"1Ô5Ø4;6Ù;> =E@À?Û0Q.‰(Œ%Þ0N-j6&ˆ ø“]Î%¤Ü! ,Á "®"°"xç'},161W5Q#¦lé¥q¨#ÚÛ "¡. 1 ” ¶PÒÙQÜýo ÆE ¬ûýã*ûM÷Ôù¸óÉôü Ø @  “áDþÁ Ø · qÿQùûö#òTøÕó†óLíúí×öáó«ó®ïÈõ¬ólö%ôe÷JøSø õûó}þnþßý ¼ýú-öTó€íºë?ëyåóäúá+äKÞôä;èvçÏç¶äTìJëáì"ëSëŸæÕädð˜ð‡õ…åLàÔÛ¢Øà¨åZãóçÛ,ÖŠÕêѨÖÇ×&ÑÀÚ@Ù÷عÕ„ß ÛAÚ$Ô|Ò/ÝúÝÞSá6ÒxÍ ÉAÅÊÆ´Ç Ã%ÇîË©ÌLÉnÆtÒÔÀÓ ÚšÊ>ǼÁÔ¿8ÉbÏ+Дпº¹õ·{²¿¸f¹˜¹g»»Dºª¸ç¸°¶œ¼j»ã¶Ü·¶³QºÌ¹þ»°¹´t²È­ªä¥ÀmÁÐÀžÃÁ¼j»s¾W»øµ™²­±\°ç®Ì®€ÃÆÀÊ2Î&ÉíÍÎÏ•ÐàÑïÈèÌ ͦÒ,ÊÉÎÛÒHÐó×@ÉÊÊšÍòÑÅgÍ<ЧÖ0ÙõÎÈìÄfÄöÀD×9ܲߺäzÝ^ÛPÜ¡Ý%ÝàãóèÜfß#Û—ÞÎÜÜâåßêîâ|Ý[ܹèÆìRðŸõ9é!ì8í©éïò½öLúïïÉóï÷úúóƒð×ìê0éÍù}ý]OúÖøØª`N ØKþ…ûÃú7ý C ·k Ø\; ì 76°  Ô ² >¡…Ñdƒx 7 _òëJ1ÖrŽÃî’Ð …Â!E}%* ¦ ²š*/‹³QW5Cðn» ò Ÿâ$2!w „#Ÿ(ð“è±ýþ§ÿ@ûqþk…Ï.ª " ïð # åî #©ø°)ý-Œíûùùƒ¦ýžûôü¨ú„ö÷ó¤õó˜ûçýWüåúêÐc ¢zþ˜þRø¯÷t3õ_ïÒí‚êÇìßîæøíMîŽì(î ëAí+éÜì ëŒó4õFò·ñCû4ýŸÿkþyRÅòyðê6èDðÿí¼öÝçUáÔáQݰß Þ4Ü‚Ú,ä×ä_å—ã"è'çàë™äMêdåóéêÞæ]åIï–ô,ãçà ÚŽ×Rà&äñä¿çáæ|á®êJÙDÓÙÓaÐàÑ;ÒÐ ÕѶÔ¹ÕÄÕêЄÏÓØöØAØu̪LjĘÀºÆUÃóÇëÇÁÔ½T¹0½×ÌÐDÒ†×4Ôz×jÔÇܹ×6ß1Ü{ÎÆÏãÑ‚ÑìÒ‹ÔÑÑ€Ó­Õ{ÌWÉɼÊtÃqÁ³Ä~¼ÁɢʂÐУÉYÓÞÙ@ÙÁÜ-ÝÝß©ãÝí×}×ÒÔéÖÖÐTÍbÐhÐÄÈ!Ò¿ÕõÚ»Ü×aÚ€× ÒÙÝ;á„߬âXãîèˆìVçåÛ&Ù×õÙÔ*Ô¦ÏbÏÓÊîÕ×ԫ٪ټѯݲâˆåbèåÛãXæ¨â¯äÃæÈäFæÌåëé¡èïäyí(ßÜOÞ;ß%ÖrÓ"ÓŒÍšÞøáFæhç\áÕäéâùéàæ íëééïîÏñÊò–ôCùø¶öFó¾öTëƒêÂéMëUæ}äßÁÝTÚ å{ãçZèÞ4Ù÷ÚÅÕê"îVò–ôŽð¬ìÝõ¨îWôøAö×ú<ùEñÄðkñMòðêÏð*ñöàøÍî"èVäÿßÌÛùéŽ[¦Aõÿ4|ažƒÿgYuÿ àþÝ tûeùÙýã†ôòòíûë%íÿrà âBüßûùü[ >ª¡qØö­Ïá*zC™ƒË} Âiº0Þ5ê1Ó. -¼ȉËùÃeÊ»È+ý”þðý" ¸øAùóæð$òxêkófñXôúóŠù’÷Ûò|ï¨óDø#é²ò©îýÛ0À ½e“8p Ø>° N Ÿ7þMóXÈÕÇ6¾Õ¾/ÔY$ÁÏ ¹*Ów ýÛ°+žÝ̨_º'àÈ{ðÍÃ*«–#ðg 0;ÚØ<ܶè¯úÞv/KãÖ0ž)éuû%æ²ý*±õçÂQËk¯4óÈ*ôÊ­È2kóðÐAý7I,Ìà×§ïzÒçÝx¥«.ô!ôÓ¸qú3«ÀkÓaÞ}Ìõö´âyñ‹¾ Åç €¶Vèçg5J¥‚î¶ä»8¶ª® ¿Êç”2Q;@°ñ¬Ínóô ÆÓÌ­ÖôÖ«4¨{ãEÊv5è°âö•(²&ÎÖ÷ÂÙ¸Öª›ÕB ¯™ã ìõ84­.µ¦¾aµjËÈ?y ƒ¾ˆÑZã¤õf5Lø¬ÊÍÇÏñÜSí"ô˾'€¶–¥/¯[â»ûÏ«þï•ÚÐîçÌÑ~½L#Uæçóý¦¹µ(ÎÖ55 Îù—{B±²8µÈר b΢€0€7i9d5z1:õ:F@{7"3”2à6}5Q4-7Â4†.,ï.Þ/Ý'$g/10¸,á.k15æ:ò:Ý?#'Æ#Ò$¥$&3'@+÷+Ò'½"„"Æ&¼ý0&4¶3V5V9C<<†>°?S@¼?¤CƒBsDj/þ.“+î,Ú*ò-*p+Ï&(…%Ü)¶)`!ÅøÓÚ-\1s4¸5²4õ:1Ñ6›:67a9»=;AC™Dæ2\/s.ø/ë*&ò'Ð"ë$†!ª- -–34 *Š-)µ6ìMA%?ýD¹IRE(L›J;AÒKæCsH~<>J<>†<ˆ7«5–8å9Ü/õ,+'(&::Ô>?CE?ÆD:ëEJOJN4L‚M‡Q"TOP²ERDîF>Gp?yFGGI†GB}CoGì?’N2P†Q;O¯U’WøTtS\TgO’OqWKTFvD2BdDŒB’EçCÕB^>>~9~:'7KNyM¦MyLÏKwFuFˆJnOGMðK'PBc=S=ñ;¬8ü7m9Ÿ4t@º@ôCøBSCI?.DíAH‘K–HËHüQT’YVFICv>ñ>0A”FM=—Eh<7ï:7ï4î0c+¬(#´"Ñ `>]@çBEA0E¹I EÿN.DßFÍBƒBîJLOiQºQßViVqXÈ><9Õ6ª56G8A4 /D/O5À2¿5›3.1-ˆ:µ=îCG0?F:i7i7ß3M3B¢GKûP2E?L=ñK¡POSžXnNýLFIDCŠQSTuX\ˆPîM©M¬VIY^^TbpVXÐZîTú]íbCfËk0`YcÝeb%i.eÄiÕmJq:gœehôfnj˜kÉn±qjo khcëjùa¤hËd vayHxòyÑ||„.x¥xs*rºw…{±{Tzvz)zÀyWoiÏg8c!f.hbj4h l=jÈlŒi~fwfbàhn7o·u|wÜi h4ca_ll¹o.j—n˜kä`‡[ºW6VqZê_,^g_7TVPKGPQ¢V^W†[û`óJaE_E,ID,G{E4@Q?ƒAÂD%9¶8x3/õ1ä@íCIKcA”K¡QBRãVStSxTàVTÆOøQP|SÀMdNI=JôLCKCOlP|EÀAD;»7Î72QºUÂ[3^ÕU­[øa5b¬`ƒa“f]f†hSk%j³l mFhdMiYmÒppl{mŠspw±z8xthcòaìa/_‹[c]âVûa_=caœ^/[ÏZfX,V@hlkìlWqŒsLxF|øÜkekfAftkOjÐn•fñmhhaâ]M^9\Ba*b¦eôdþehaøiÇlÙisjp½tUsïeÎb_^ê_[bN\jXÂ[žYÊUQ>MNÎ`>cgdÐdlh[fËkyfƒg¿bæcj+^uY¯WýV2UhPOPùL0X?V™YÅWÄ^æbG`²`åh_:]wXgWÿ\çb:Y§b0T‚OOßMK„JFÍGISJS·V1UÉVÎSÚWkT•WÌX™Z¤VPWR_dfålLoôQÂMEN‹M‹K InHNCúCÅP°QeVçXöYQ^Ãb—eÄ_Þ[Á\˜VêX|Ubd×hýj·`«]*Wû^UôY€knsu)oAmhBc†h¿uÌzˆy›|ç|Öu s¿r£síoXpppÒnÔs$p_o:sÜs keÒadFwÀ{ã~R~™€„ˆWŒ‹’ €‚¯%€â„ó‚d€XzIv>uuq`mn³htFsMw÷wer|žXæ‚À†+‡~ŠÔ‹½ŒÁMï}†~q‚/}ax³tgtgrào;nÅr)kypølãvv€{z¿wBº„g†z‰3ˆäŠð‡…R‡sƒ4ƒ™‰·ŒM°”v—.~Óz´vót2wšz²~Åz]€Ë~wt*nLkvrl*f¥c}dSf(ix`|hñ_ë\ÓYIW¦Yr[³^ÖX"TcOTM"SiXeOXZ‚MrH–H½DþGžBE>~95MdMŸM)KiR«SpPxWbQ3XDU-VNÇMÍHF"PòVßY}YE)?|=L:=!7+4È7‘/ù?J={>z;&?ý>Ó:xB‡9¹AÀ=\CD@Ñ?#IäJäK÷P?¸<36Í4x<@ã4ì/à/õ,O.V-º-„--6424Ä4à2\9´7Ä7ø2{0Â;—A9:úD¨/™*u&Ø#»(J+"u*¼'!#ï%!m$ð!Lh!áJ*+c)ì( 1,31õ*š)#7!€*À0r1[2S !~ £ø"e  i Í´¡â“ n"s g q(|*Î0¡3ƒ6%6’8oË–ª "'$(s+^-1/tü R ó ‘n G #гlu$à?¯«”ÆCG Ûº#ôÂ#V% d ËWÍ +S Z ŽW¾ Ë Â + *°æ m~ Ž€›ø™ > ‚G»º!í¡$^)--,$(Ý-*.2š,0š6Ë4ý)ø*ˆ-µ1=%\&e)$|,X/4½8/,w'U%; ÿ %5Ó;>>pBï;Ž< ??aCB<ˆ<¹9ÕBa;€< @‹C‹6Û2ž-î,A,X@þE3J}NDšHøI H\J÷OPøU[NSRCWPëZTT)XéM MÞOJR¨HüGãD{?F;B;¹6³L­M­STVJK[HIDãUZ^^wb–ZËWÓUÐW´]Œa'a1eP_º`ªb¯_6\\4_naüVˆ_„b¨hfkCazjDo¨p¹tÛqo¾r·tQråmmán‡qÄi6ijÓfÖj‰fŒhfhkOkrpÇsføgHbËcª`rºwê{ÿyd~ô€G|©…{¼|~ŠØvs€‡2z[yAvavÔs„p[jg]r€x y|7~Mq‚I‡chrbäa2_´4?6=0028nżF ¬±i“uŸix]1ibn™sâv%r‘mîs1{’ N}€ïd„dð`•\ý_¡`WTƒd’_u\_ódÇVî_/[-nŠn r=u›s„rÐzßy:}| €…gcÒ]»QhJ ›_ ^9ƒmK-17ªEJü 6P+óUµsK/µf9_¸WOÔ2Æލ‹NIå=v6õoWòGWrü]ÛRmFÛ8µŒD"[ h€04/B]©T,X(›T­c—w +e‡… x¥Df>X1FÝLE[ü-à4ÜyOÙA=&˜ƒKîQ-ðSÒX—u]J‚KQJ©d<ÈsûRã"Š2Æ[•<JùK`èsÿy„EÏ\Hž=ö(¤µ‹h:g"”&Ì;&{†r\31yÉ…6kÐéÍ{1R9˜@_:ˆN%„eûI${~Sg[\Ópc=(i•Ý$FT´¶J|’Æ!˜Zt“w zŽ^sÛ(ÚPÎÖL‹I7‘“ê´vF zv©r¿KþQ†q/¾ qw<&–Nߢ’-Ã-–@ñEÏ -.…+‰jXÏ£€0€ÿLmOœþ¡Yüc 1\ ?¿S¥g¯Ü‰=ÜúY"Òú;I í  Ò"ú'­~!$¼(ä@˜@z¶#B&°,/õ$x / ¥c®$Ìà#øö,+1%4¡9p0Z-,‰)¿/b2m5z7–<2 0,N5~4N5»:,>0ê2Q,ã9š=tBhFœ:÷6ž48ÖB!FÓJgOEKIÿL{L›PqP‘HKsM QgI DPMcI•JúORóF)GIqGyJ^I6EùI|FDHOôT{Yz]žSíYH]Ô_!c¢] [_/]¤aø[A\^üb=V¿WmT]¨_¢e^g³\ V¤S_PcSÒg„m5pt¼nÞm¥oék¹jcrŠu6vv™iÓe~g3dicr_0a(k×mfn)lœrlpMpÛkªjŸgùbÙ`%]‹_``œd±^HdÆ`Ø`»^_ã\Âeg/dïcm$puÎvÐxñecA]\cÉi6m jDZŒTÝS³P¹RR8L“PåV$U*WT†WqT·W¤O'[©]´ZXécWföelpX"TOM”RæOMO½K®LõQðI;M HÿIóF¼G¡C=øBÌN]OpP9NóT3SµNìXN¦WýS+R SÚNñNX%]²a9aÇf¶KÕGBª?‹EH§B‡>`@¤@†:B8I4W9¸3[6§BÞE¨BkD¹GšHCl=J::·9Â4N1§2L6v.dË>¡;œ<#8l=;:?4os<,>0;"5n2Î< 3‘.0-z)§,¶, 'ê,‰0Ä/ë/é,á4(4#8Ñ/3F3Œ.¶-î8g=^BF¾K‹+^&n"T%$x'Ò&Ÿ$K%„#~öl 8%±&w#<#hìe–mÂIíé æF  ÝH°Ìô«ÝùY g| Àøžg éiÍ D$¹"à%¶'Î*‡&¹"B(K Iן” ø[Úᨠë o“"$=%&&u%ú ˆ%)'#2$(ƒ+90±+xX%hÑ&sÒ$ ̶b¿"&A&8'6+ -'%+%¨!"&b+ð./ç34;y,®ú Æ#7ߣ.Ó"°'€*[+Ý+ /ü2¥5"8Ê+D.m+l-±13¾73¼8õ6î&K"Æ#Ù$à"ü#¦% E(_-=)Æ0j°ÿq¬“+!>ÿ FœcÒx P"ç!Ò¡×O"Æ(b)È.*“*O'P-D'-!*)ð&1'&º)m#-#h(Ì#‰#{(Ã+!ÉŸ­ÿ*Î/ä4;7£1s-Í*¨-–'h*X'=4†8Á7Ì;•9y>ú5V@831ë4B6§,*3–5Ã;¿>:3ô-þ+W-Ï&l>)CÍEÈI³E¨BýDQD+G´@“A{@ø<Ó?Û?hC¹F9å5Î907DòINMQ6I”MYKéR~P TOÀTÏUYV Z¨VÔP³P­Q¦TUKšJƒDßNfOmP+UÊX L=LÝOKBOLöX"]“aFdô_K\``cðbõf“cŽf9eØi›mÖo’pw^#\µYoUQY¼\}a*[(b›^ë[=W¯VMQÛZÈ`Y`,YÃXnTnR*S¤O¼K…HmRaUâS°Z²KMGEEIÖE»B¸Dâ?A>%D A;’:8}3X/Ö,í0£0,Ú.*À-÷374434Ù3Ú2:®4„3$-q,429ã:P73>* $#E /%Ž$³&ˆ#ì'„+B-4)È(­2ý5C5°:þ'ñ$A‘É"Ö7 ¼_eËû˯ ë æ£  uð%<"º#X-0'­-%1.èÇwŒ¾‚&ŽÎ³=Ÿt  =ü«b´ê#$$¤''}(÷¾ 4N¥µ\}" !·J)þ¯ý÷åõ•Ó ÍN ›4 ´“ e õz-ø Zy¤þT!ÿ7úûtøù4žè'¶é ØŽ µ#þuýR€ _Û{/Â]úòõ¡ó>ð˜òTì§é_ãÞâñôEòbô ðÇôzó>ö/÷×öÎùûmúLühÌ›÷’ö=úzú¨ýÑõD°@› 8_ x” + ýüùÿ qrÓmRu©nÿg7cÂe`h#lw;¨A<Á6 ;h>D@cA@_>M@íCi>Ö:[5ã:í9ß:j8Ï797Î8Ã56¸9d7ª6ú8z9×59A8=y=4?-@â?ä?lD9JOLãNObBUCÓˆË!X_VBÂï…Œ75bt‘l(Fè=2>õ^u°b/?ƒGÔ6™/ `fàBÓ>€-&æ nL Þ/Y3%‰ÄIø2„‚_…*|¥ðº9\úL¤Vb Å[ÑgZ½KX6éeϵC¿N#VG=rr}"lú¼ 'U-úQL ¨_ :ºYýu6n€ô5ùì ÈŽ 2z8ôàKÒ"Ô |B•P5áGXd&g`ò´,müìw…Qd6qA" ž%{ê\®Y‹¦O[bRXè]’’b_>yDn:eË5Mc·po2º~T¨„æX‡#KÄ_´8”Pë¦ñN'FüVJ ï.ReUBY#ñ¤@¹0¸33Rí<þK)¥rj6F± Í, TäjYFÅweŠâhPs™Yz!ô5p\á? &Ç6”xÜa,ƒ^¶h¨k÷³£€ €0€ €è¡€0€–'l«\0Vê‹7£[7<1›0¡>”-1'j<È&ò.….Õ,ì'U8:µ/Å0ñ*»+44Ù32 4l2‹1`9a0¶2È-Y!è­!¡"Ã(Ü+Ê5 7m ‡Ã]Üš&H×(Ç!Þ%É$|!Þ# "`;¯Kwi(PfD!p]EP$Ö,¦7?¢ô/ã“ÛXúÁÀ»'L1iß Ï|#w!%C,i)+9Ú5˜¯|ßR(–$†Ûž²!«J%Æ6U'ìHN: 2cJB?zQé|$é"B- 3? a&&3:Ý%ã/M,i4Ù:µ%ø+e/§8Ë-‹//5ƒ;áPE$Q"e^r-rìy­wLFŸX3PcZW²EK<ù.S4FnùGJiÒ2ª()þ*k-–/%9X/b3?BÌ8¸Gé:7ÑG3Ö/Š)! Ù&ÀJñ"›!['×&«\*#ïg.…2½,‡7Z/§C€UEI¢M€1¹/Š'œ%C-©8![6b\ï¼t•XmáSî)6+ …Ôre#ú+R*Å=£À žü![('Iüj|tÁŽv¿«š¶­ ñŸŒÜj™‡'Ly-­'õ#½À%Y+ò/2‹D M:Wê$Ö)^+òGhù!˜P$I!¡$™,,¯6-5¶ ž!p ä(¾2c("ˆ#Œ#!ƒ18&è'"#å)àÔÀ!Àµ~â N!y$T$®)+%03­Aæ(æ2å1A:H:>€MIÉ_()^& -‹0y)@1#8IH¼Yœ$Á%+ç%‰!˜#d"j+—)I*Š1Ã;á=<ÈI3g¢ƒ!£¿7Ü?o2m8!QSEõ@.2È;7VIò& #Ü$Ì'$&H%€"õ){*+—.")Ë6×;¦;‡?ÉBó[!{ äÀ0ñ4ž4±@3 .¸5Q/§863r.r&µ.:=){#-+R-³9“3]9vNwL«É]Ï$"xÆñ#(#Ò(<Mž¸g"Í&p4”BàN>È#Òš -ðb2B?"#%&.¸DGEõwæöÌ;#ª/Å!¡"s3,*Ð0ñP<\™ ðù–(n&µÔÙK²ˆ%ã«/Š!!¶%»)þ,¯»•¹„$¤0>D\Uw ’Œ#^ízB"s"K%&$6(n–‘ë(n,L=+>MQ6ò‚ûY˜ ±'7't#ï# CYB}„úô|&H%&<³Kô.ê'‡/‚ë¿ÓúnÈøãy$",L.v!S@&H/( dïøÙ :·äS"°!> ³›XT…$ô-P ¶¾ žß+Ýj}ÝÒ!y ”© #Ç- *%1`4a<æYì!«'¯$Ì/÷2DÔfa–FÛ a!H(w/:&p,á4±2m&ò$?H%KÇHN=£3Â2Ò9ÅJ¹pÙšâ™R¥«]3 3·727/($T+z&$?7ÑI¿HžJLV߀«›1=‰ãQ|KÇE‘P\7Ç>¨?z5ÓJÃXR€Yâ<ð<:òIfAÒN¡R÷rj>CD¡;¯=ó`™€ ¨¿ßùÃ:Ô6ÿ)^/C€N¿D*%‰&Ý §$þ%C+µFE?['L2m20¡<Û-(? 2ú7dJÃa_•tÁ^‘,ö1#(Œ.h/”,¹,','×Û9#ïŸ$"Í!«#O*C>0/-©2>±KÜAcL]>?¿4ã/MH=`^™R½}Ãù-;)S-©6K+*²0y&˜4±+2P5Ê2‹9X/b)†0É9Ð'7!¡'$(d/%5¶1s-¾?HEK: 8:z-Û3Â=IG^H/K/b+!Þ"°2‚?„Sa¨PÒ%îVyÈÑ"Ã1#'âr ±(1)†)^:" ¼"B".%ø!è!û%±)q)h#((O'/0ÞKPXyfŠO&e'õ(O.Â&ò%Ù'ÿEt&¢Ärd$Ö0¡$"%Ù5Ž2ïLËJâOػά|ãô¸~"Ã#‚&=#½-;+¬¥‚BïÞ :˜!˜°d€Äì §¯)à¤Ã½¯#!¡7OFªS=WD&zE#Ò&*/%*0—4a,t"#6#?„39N7¾6K,~D—3T;ìFú2•7E7mR÷8^8W»a÷TV?«/Å8Ö;œDGW”VÕ:¿0èLËZcX>ZY>%@’Kw:µK'BÂVÁHÙ^~VÕdmAYNH_ÈPEHXbüY¹3gZY¯T-FÈfäSÝ~J^›u”U\îeË;L>CCvJ¦x½iavl¡_?J`Y¹W%Ysa²TábÀbçW‰tÁˆ]iOyýƒ…«ÂzㇾqçŒ1 fukä¥g‹x‚Bˆš„“QókW[|hˆƒÖt \”ÿo£ñ‹×…‡cy uD3oh’sw‹Užñ{ …Gim‚ù¢ÐË¿0ƒ6›È÷—@†á£û«Œ(‘d–´m›”ç“0ŽŽ"lñvµ,¼ Eˆ¸´Yš.ºÖ¶Æ•$º]¿|ÃPÃPÃPÃPÃPÃPÃPÃP¤€0€ €è¡€0€èèèèèèèèèèèèèèèèèèèèèèèèèèXXXXèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèXXXXèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèXXXXèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèôôôôèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèXXXXXXèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèôôôôèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè»»»èèèèèèèèèèèèèèôôôôèèèèèôôôôôèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè»»èèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè»»»»èèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèôôôôèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèôôôèèèèôôôôôôèèèèè»èèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè»»»»èèèèèèèèè»»»»»èèèèèèèèèèèèèèèèèèèèè    èèèèXXXXXèèèèèèèèèèèèèèèèèèXXXXèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè»èèèèèèèèèèèèèèXXXXXèèèèèèèèèèèèèèèèèèèè»èèèèèèèèèèèèèèèèèèèèèèèèèèôô»»»»»èèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€¢€0€ €0€ €B@¡€ÿ#­¨¢€é×H£€tž ¡€0€ €B@¡€þÄS€¢€žW(£€e›¸¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€#¡€¢€0€ €0€ €B@¡€ˆ¬H¢€è£€áh¡€0€ €B@¡€ÿv¿H¢€.¸£€®†Ø¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€;¢€L¡€¢€0€ €0€ €B@¡€ÿÌ€¢€_Ú8£€¼´˜¡€0€ €B@¡€"l€¢€Ÿˆ£€϶ð¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€W¢€_¡€¢€0€ €0€ €B@¡€8„À¢€é2`£€uKX¡€0€ €B@¡€ƒÇ8¢€ÞU £€v—`¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€f¢€v¡€¢€0€ €0€ €B@¡€‡éТ€fÜ£€o뀡€0€ €B@¡€;rÀ¢€3äP£€tÎX¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€}¢€•¡€¢€0€ €0€ €B@¡€üx¢€êŽ£€Ô‡¡€0€ €B@¡€ÿ1ý¸¢€3 h£€Ð%(¢€0€ €¡€¡€1€ €0€ €1€®€0€ €2Z6S¡€A¢€¡€0€ €ס€¢€«€ ÆÌ¡€1€´€0€ €¡€0€ €ס€¢€¡€Oxygen Binding¢€0€NCrystal Structure Of The Oxy Myoglobin Free From X-Ray- Induced Photoreduction£€0€NMol_id: 1; Organism_scientific: Physeter Catodon; Organism_common: Sperm Whale¶€0€¢€0€ €Physeter catodon¡€ sperm whale£€1€0€ €taxon¡€ €&¤€1€Physeter macrocephalus¥€0€ € €0€ €Physeter¡€catodon£€¢Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Cetacea; Odontoceti; Physeteridae; Physeter¤€¥€¦€MAM¢€0€ € ¡€ ¢€™¦€¡€A™VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAILKKKGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG¢€0€ €0€¡€0€ € ¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'¢€0€ € ¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'£€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'¤€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'¥€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'¦€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'§€0€ €¡€ ¢€ £€0€ €'¡€#¢€#£€'¤€'¨€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'©€0€ €¡€ ¢€ £€0€ €'¡€t¢€t£€t¤€'ª€«€0€ €'¡€$N¢€r£€Ö¤€'¬€­€0€ €'¡€¢€£€¤€'®€'¯€'°€ ±€в€ ¸³€ ¸´€FPµ€N ¶€ˆ·€0€ €¡€ ¢€ £€¤€¸€0€ €¡€ ¢€ £€¤€¹€£€0€¡€0€ € 88.0280547128247¡€ 0.610865238198015¢€ 0£€ 0¤€ 40.6279553734552¥€ 137.398321540861¦€0€ € -0.356752574443817¡€ 0.275598227977753¢€ -0.892617642879486£€ 0¤€ -0.11603382229805¥€ 0.93501877784729¦€ 0.335065364837646§€ 0¨€ 0.926963150501251©€ 0.223108559846878ª€ -0.301593989133835«€ 0¬€ -13.572847366333­€ -20.9213695526123®€ -5.73045969009399¯€ 1§€0€ € -4.19140487804878¡€ 19.9073087108014¢€ 15.5211358885017