£€0€ €0€ €0€ €ã¡€0€ €2MM1£€0€ €0€ € € þ¡€¡€0€ €ס€¢€¢€0€ €Protein Data Bank¡€ €¡€0€ €ס€¢€¢€¡€0€ €PDB¡€¡€2MM1£€¡€0€ €Ç¡€¢€¤€¡€0€ €0€ € €0€0€ €¡€0€ €Hubbard£€ S.R.Hubbard¤€S.R.0€ €¡€0€ € Hendrickson£€W.A.Hendrickson¤€W.A.0€ €¡€0€ € Lambright£€ D.G.Lambright¤€D.G.0€ €¡€0€ €Boxer£€ S.G.Boxer¤€S.G.¡€0€ €¡€0€ €Ç¡€¢€¤€«€1€¤€0€ €1€ €TX-ray crystal structure of a recombinant human myoglobin mutant at 2.8 A resolution.¡€0€ € €0€0€ €¡€0€ €Hubbard£€ S.R.Hubbard¤€S.R.0€ €¡€0€ € Hendrickson£€W.A.Hendrickson¤€W.A.0€ €¡€0€ € Lambright£€ D.G.Lambright¤€D.G.0€ €¡€0€ €Boxer£€ S.G.Boxer¤€S.G.¡€ €~Howard Hughes Medical Institute, Department of Biochemistry and Molecular Biophysics, Columbia University, New York, NY 10032.¢€ €0€ €1€¤€ J. Mol. Biol.¥€ J Mol Biol§€ 0022-2836 €Journal of molecular biology¡€0€ €¡€0€ €Æ¡€¢€¡€213¢€2£€215-218¨€eng¬€­€1€0€ €¡€¡€0€ €Æ¡€¢€0€ € ¡€¡€0€ €Æ¡€¢€¤€¥€£€1€ €#¼Ø¬€#¼Ø¢€0€ €0€ €[X-Ray Crystal Structure Of A Recombinant Human Myoglobin Mutant At 2.8 Angstroms Resolution¡€Oxygen Transport¢€,Mol_id: 1; Organism_scientific: Homo Sapiens£€¦X-Ray Crystal Structure Of A Recombinant Human Myoglobin Mutant At 2.8 Angstroms Resolution Oxygen Transport Mol_id: 1; Molecule: Myoglobin; Chain: A; Engineered: Yes§€ÿ¡€0€0€ €¡€0€ €A£€SEQRES¨€¥€0€¢€0€ € Homo sapiens¡€human£€1€0€ €taxon¡€ €%†¤€1€man¥€0€ € €0€ €Homo¡€sapiens£€šEukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo¤€¥€¦€PRI¢€«€ h`c£€0€0€ €¡€ 1 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 2 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 3 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €¡€ 4 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 5 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 6 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 7 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 8 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 9 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 10 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ € ¡€ 11 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 12 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 13 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 14 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€40€ €¡€ 15 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 16 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 17 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 18 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 19 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 20 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 21 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 22 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €¡€ 23 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 24 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 25 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 26 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 27 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 28 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €¡€ 29 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 30 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 31 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ € ¡€ 32 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €!¡€ 33 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €"¡€ 34 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €#¡€ 35 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €$¡€ 36 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €%¡€ 37 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €&¡€ 38 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €'¡€ 39 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €(¡€ 40 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €)¡€ 41 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €*¡€ 42 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €+¡€ 43 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €,¡€ 44 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €-¡€ 45 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €.¡€ 46 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €/¡€ 47 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €0¡€ 48 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €1¡€ 49 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €2¡€ 50 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €3¡€ 51 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €4¡€ 52 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €5¡€ 53 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €6¡€ 54 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €7¡€ 55 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €8¡€ 56 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €9¡€ 57 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €:¡€ 58 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €;¡€ 59 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €<¡€ 60 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €=¡€ 61 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €>¡€ 62 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €?¡€ 63 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €@¡€ 64 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €A¡€ 65 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €B¡€ 66 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €C¡€ 67 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €D¡€ 68 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €E¡€ 69 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €F¡€ 70 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €G¡€ 71 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €H¡€ 72 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €I¡€ 73 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €J¡€ 74 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €K¡€ 75 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €L¡€ 76 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €M¡€ 77 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €N¡€ 78 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €O¡€ 79 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €P¡€ 80 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Q¡€ 81 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €R¡€ 82 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €S¡€ 83 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €T¡€ 84 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €U¡€ 85 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €V¡€ 86 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €W¡€ 87 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €X¡€ 88 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €Y¡€ 89 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Z¡€ 90 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €[¡€ 91 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €\¡€ 92 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €]¡€ 93 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €^¡€ 94 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €_¡€ 95 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€10€ €`¡€ 96 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €a¡€ 97 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €b¡€ 98 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €c¡€ 99 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €d¡€ 100 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €e¡€ 101 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €f¡€ 102 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €g¡€ 103 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €h¡€ 104 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €i¡€ 105 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €j¡€ 106 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €k¡€ 107 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €l¡€ 108 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €m¡€ 109 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €n¡€ 110 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €o¡€ 111 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €p¡€ 112 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €q¡€ 113 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €r¡€ 114 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€:0€ €s¡€ 115 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €t¡€ 116 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €u¡€ 117 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €v¡€ 118 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €w¡€ 119 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €x¡€ 120 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€+0€ €y¡€ 121 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €z¡€ 122 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €{¡€ 123 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €|¡€ 124 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €}¡€ 125 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €~¡€ 126 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €¡€ 127 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €€¡€ 128 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 129 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‚¡€ 130 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ƒ¡€ 131 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €„¡€ 132 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €…¡€ 133 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €†¡€ 134 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‡¡€ 135 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €ˆ¡€ 136 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €‰¡€ 137 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Š¡€ 138 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €‹¡€ 139 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €Œ¡€ 140 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €¡€ 141 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€ 0€ €Ž¡€ 142 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€%0€ €¡€ 143 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €¡€ 144 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€.0€ €‘¡€ 145 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €’¡€ 146 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€70€ €“¡€ 147 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€"0€ €”¡€ 148 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €•¡€ 149 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €–¡€ 150 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €—¡€ 151 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€(0€ €˜¡€ 152 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€0€ €™¡€ 153 ¢€¢€0€ €¡€0€ €Standard residue dictionary¡€ €¡€¤€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€0€ €0€ €¡€ ¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€ ¢€ 0€ €0€ €¡€ ¢€¡€0€ €¡€!¢€0€ €0€ €¡€!¢€¡€0€ €¡€"¢€ 0€ €0€ €¡€"¢€¡€0€ €¡€#¢€0€ €0€ €¡€#¢€¡€0€ €¡€$¢€ 0€ €0€ €¡€$¢€¡€0€ €¡€%¢€0€ €0€ €¡€%¢€¡€0€ €¡€&¢€ 0€ €0€ €¡€&¢€¡€0€ €¡€'¢€ 0€ €0€ €¡€'¢€¡€0€ €¡€(¢€ 0€ €0€ €¡€(¢€¡€0€ €¡€)¢€ 0€ €0€ €¡€)¢€¡€0€ €¡€*¢€ 0€ €0€ €¡€*¢€¡€0€ €¡€+¢€0€ €0€ €¡€+¢€¡€0€ €¡€,¢€ 0€ €0€ €¡€,¢€¡€0€ €¡€-¢€ 0€ €0€ €¡€-¢€¡€0€ €¡€.¢€0€ €0€ €¡€.¢€¡€0€ €¡€/¢€ 0€ €0€ €¡€/¢€¡€0€ €¡€0¢€ 0€ €0€ €¡€0¢€¡€0€ €¡€1¢€ 0€ €0€ €¡€1¢€¡€0€ €¡€2¢€ 0€ €0€ €¡€2¢€¡€0€ €¡€3¢€0€ €0€ €¡€3¢€¡€0€ €¡€4¢€ 0€ €0€ €¡€4¢€¡€0€ €¡€5¢€ 0€ €0€ €¡€5¢€¡€0€ €¡€6¢€ 0€ €0€ €¡€6¢€¡€0€ €¡€7¢€0€ €0€ €¡€7¢€¡€0€ €¡€8¢€ 0€ €0€ €¡€8¢€¡€0€ €¡€9¢€0€ €0€ €¡€9¢€¡€0€ €¡€:¢€0€ €0€ €¡€:¢€¡€0€ €¡€;¢€ 0€ €0€ €¡€;¢€¡€0€ €¡€<¢€ 0€ €0€ €¡€<¢€¡€0€ €¡€=¢€ 0€ €0€ €¡€=¢€¡€0€ €¡€>¢€ 0€ €0€ €¡€>¢€¡€0€ €¡€?¢€ 0€ €0€ €¡€?¢€¡€0€ €¡€@¢€ 0€ €0€ €¡€@¢€¡€0€ €¡€A¢€0€ €0€ €¡€A¢€¡€0€ €¡€B¢€0€ €0€ €¡€B¢€¡€0€ €¡€C¢€ 0€ €0€ €¡€C¢€¡€0€ €¡€D¢€ 0€ €0€ €¡€D¢€¡€0€ €¡€E¢€ 0€ €0€ €¡€E¢€¡€0€ €¡€F¢€ 0€ €0€ €¡€F¢€¡€0€ €¡€G¢€0€ €0€ €¡€G¢€¡€0€ €¡€H¢€ 0€ €0€ €¡€H¢€¡€0€ €¡€I¢€0€ €0€ €¡€I¢€¡€0€ €¡€J¢€0€ €0€ €¡€J¢€¡€0€ €¡€K¢€ 0€ €0€ €¡€K¢€¡€0€ €¡€L¢€ 0€ €0€ €¡€L¢€¡€0€ €¡€M¢€ 0€ €0€ €¡€M¢€¡€0€ €¡€N¢€ 0€ €0€ €¡€N¢€¡€0€ €¡€O¢€ 0€ €0€ €¡€O¢€¡€0€ €¡€P¢€0€ €0€ €¡€P¢€¡€0€ €¡€Q¢€ 0€ €0€ €¡€Q¢€¡€0€ €¡€R¢€ 0€ €0€ €¡€R¢€¡€0€ €¡€S¢€ 0€ €0€ €¡€S¢€¡€0€ €¡€T¢€0€ €0€ €¡€T¢€¡€0€ €¡€U¢€ 0€ €0€ €¡€U¢€¡€0€ €¡€V¢€ 0€ €0€ €¡€V¢€¡€0€ €¡€W¢€ 0€ €0€ €¡€W¢€¡€0€ €¡€X¢€0€ €0€ €¡€X¢€¡€0€ €¡€Y¢€ 0€ €0€ €¡€Y¢€¡€0€ €¡€Z¢€0€ €0€ €¡€Z¢€¡€0€ €¡€[¢€0€ €0€ €¡€[¢€¡€0€ €¡€\¢€0€ €0€ €¡€\¢€¡€0€ €¡€]¢€ 0€ €0€ €¡€]¢€¡€0€ €¡€^¢€0€ €0€ €¡€^¢€¡€0€ €¡€_¢€ 0€ €0€ €¡€_¢€¡€0€ €¡€`¢€ 0€ €0€ €¡€`¢€¡€0€ €¡€a¢€ 0€ €0€ €¡€a¢€¡€0€ €¡€b¢€ 0€ €0€ €¡€b¢€¡€0€ €¡€c¢€ 0€ €0€ €¡€c¢€¡€0€ €¡€d¢€0€ €0€ €¡€d¢€¡€0€ €¡€e¢€ 0€ €0€ €¡€e¢€¡€0€ €¡€f¢€ 0€ €0€ €¡€f¢€¡€0€ €¡€g¢€0€ €0€ €¡€g¢€¡€0€ €¡€h¢€ 0€ €0€ €¡€h¢€¡€0€ €¡€i¢€ 0€ €0€ €¡€i¢€¡€0€ €¡€j¢€0€ €0€ €¡€j¢€¡€0€ €¡€k¢€ 0€ €0€ €¡€k¢€¡€0€ €¡€l¢€0€ €0€ €¡€l¢€¡€0€ €¡€m¢€ 0€ €0€ €¡€m¢€¡€0€ €¡€n¢€0€ €0€ €¡€n¢€¡€0€ €¡€o¢€ 0€ €0€ €¡€o¢€¡€0€ €¡€p¢€ 0€ €0€ €¡€p¢€¡€0€ €¡€q¢€0€ €0€ €¡€q¢€¡€0€ €¡€r¢€ 0€ €0€ €¡€r¢€¡€0€ €¡€s¢€ 0€ €0€ €¡€s¢€¡€0€ €¡€t¢€0€ €0€ €¡€t¢€¡€0€ €¡€u¢€0€ €0€ €¡€u¢€¡€0€ €¡€v¢€ 0€ €0€ €¡€v¢€¡€0€ €¡€w¢€ 0€ €0€ €¡€w¢€¡€0€ €¡€x¢€0€ €0€ €¡€x¢€¡€0€ €¡€y¢€0€ €0€ €¡€y¢€¡€0€ €¡€z¢€ 0€ €0€ €¡€z¢€¡€0€ €¡€{¢€0€ €0€ €¡€{¢€¡€0€ €¡€|¢€0€ €0€ €¡€|¢€¡€0€ €¡€}¢€0€ €0€ €¡€}¢€¡€0€ €¡€~¢€ 0€ €0€ €¡€~¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€€¢€0€ €0€ €¡€€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€‚¢€0€ €0€ €¡€‚¢€¡€0€ €¡€ƒ¢€0€ €0€ €¡€ƒ¢€¡€0€ €¡€„¢€0€ €0€ €¡€„¢€¡€0€ €¡€…¢€ 0€ €0€ €¡€…¢€¡€0€ €¡€†¢€0€ €0€ €¡€†¢€¡€0€ €¡€‡¢€ 0€ €0€ €¡€‡¢€¡€0€ €¡€ˆ¢€ 0€ €0€ €¡€ˆ¢€¡€0€ €¡€‰¢€ 0€ €0€ €¡€‰¢€¡€0€ €¡€Š¢€0€ €0€ €¡€Š¢€¡€0€ €¡€‹¢€ 0€ €0€ €¡€‹¢€¡€0€ €¡€Œ¢€ 0€ €0€ €¡€Œ¢€¡€0€ €¡€¢€ 0€ €0€ €¡€¢€¡€0€ €¡€Ž¢€0€ €0€ €¡€Ž¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€¢€¡€0€ €¡€‘¢€0€ €0€ €¡€‘¢€¡€0€ €¡€’¢€0€ €0€ €¡€’¢€¡€0€ €¡€“¢€ 0€ €0€ €¡€“¢€¡€0€ €¡€”¢€ 0€ €0€ €¡€”¢€¡€0€ €¡€•¢€ 0€ €0€ €¡€•¢€¡€0€ €¡€–¢€0€ €0€ €¡€–¢€¡€0€ €¡€—¢€0€ €0€ €¡€—¢€¡€0€ €¡€˜¢€0€ €0€ €¡€˜¢€¡€0€ €¡€™¢€0€ €¡€0€ €1¨€£€0€0€ €¡€ 154 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 155 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 156 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 157 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 158 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 159 ¢€ €0€ €¡€0€ €1¨€£€0€0€ €¡€ 160 ¢€ €0€ € ¡€0€ €1¨€£€0€0€ €¡€ 161 ¢€ €¢€0€0€ €0€ €¡€¢€¡€0€ €¡€¢€0€ €0€ €¡€]¢€¡€0€ €¡€¢€£€0€0€ €¡€0€ €HEM£€¢€ÿ£€0€X¤€0€0€ €¡€FE ¢€0€FE £€ 0€ €¡€ CHA¢€0€ CHA£€ 0€ €¡€ CHB¢€0€ CHB£€ 0€ €¡€ CHC¢€0€ CHC£€ 0€ €¡€ CHD¢€0€ CHD£€ 0€ €¡€ NA ¢€0€ NA £€ 0€ €¡€ C1A¢€0€ C1A£€ 0€ €¡€ C2A¢€0€ C2A£€ 0€ € ¡€ C3A¢€0€ C3A£€ 0€ € ¡€ C4A¢€0€ C4A£€ 0€ € ¡€ CMA¢€0€ CMA£€ 0€ € ¡€ CAA¢€0€ CAA£€ 0€ € ¡€ CBA¢€0€ CBA£€ 0€ €¡€ CGA¢€0€ CGA£€ 0€ €¡€ O1A¢€0€ O1A£€ 0€ €¡€ O2A¢€0€ O2A£€ 0€ €¡€ NB ¢€0€ NB £€ 0€ €¡€ C1B¢€0€ C1B£€ 0€ €¡€ C2B¢€0€ C2B£€ 0€ €¡€ C3B¢€0€ C3B£€ 0€ €¡€ C4B¢€0€ C4B£€ 0€ €¡€ CMB¢€0€ CMB£€ 0€ €¡€ CAB¢€0€ CAB£€ 0€ €¡€ CBB¢€0€ CBB£€ 0€ €¡€ NC ¢€0€ NC £€ 0€ €¡€ C1C¢€0€ C1C£€ 0€ €¡€ C2C¢€0€ C2C£€ 0€ €¡€ C3C¢€0€ C3C£€ 0€ €¡€ C4C¢€0€ C4C£€ 0€ €¡€ CMC¢€0€ CMC£€ 0€ €¡€ CAC¢€0€ CAC£€ 0€ € ¡€ CBC¢€0€ CBC£€ 0€ €!¡€ ND ¢€0€ ND £€ 0€ €"¡€ C1D¢€0€ C1D£€ 0€ €#¡€ C2D¢€0€ C2D£€ 0€ €$¡€ C3D¢€0€ C3D£€ 0€ €%¡€ C4D¢€0€ C4D£€ 0€ €&¡€ CMD¢€0€ CMD£€ 0€ €'¡€ CAD¢€0€ CAD£€ 0€ €(¡€ CBD¢€0€ CBD£€ 0€ €)¡€ CGD¢€0€ CGD£€ 0€ €*¡€ O1D¢€0€ O1D£€ 0€ €+¡€ O2D¢€0€ O2D£€ ¥€0€0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€!¢€ÿ0€ €¡€¢€ÿ0€ €¡€%¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€"¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€ ¢€ÿ0€ € ¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€¢€ÿ0€ €¡€ ¢€ÿ0€ €!¡€"¢€ÿ0€ €!¡€%¢€ÿ0€ €"¡€#¢€ÿ0€ €#¡€$¢€ÿ0€ €#¡€&¢€ÿ0€ €$¡€%¢€ÿ0€ €$¡€'¢€ÿ0€ €'¡€(¢€ÿ0€ €(¡€)¢€ÿ0€ €)¡€*¢€ÿ0€ €)¡€+¢€ÿ0€ €¡€0€ €HOH£€¢€ÿ£€0€X¤€0€0€ €¡€ O ¢€0€ O £€ ¥€0€£€0€0€ €¡€0€ €PDB secondary structure¢€0€0€ €¡€ 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€ 2¢€¤€ €¡€¡€0€0€ €¡€¢€$0€ €¡€ 3¢€¤€ €¡€¡€0€0€ €¡€$¢€*0€ €¡€ 4¢€¤€ €¡€¡€0€0€ €¡€3¢€:0€ €¡€ 5¢€¤€ €¡€¡€0€0€ €¡€:¢€M0€ €¡€ 6¢€¤€ €¡€¡€0€0€ €¡€R¢€`0€ €¡€ 7¢€¤€ €¡€¡€0€0€ €¡€e¢€w0€ €¡€ 8¢€¤€ €¡€¡€0€0€ €¡€x¢€{0€ € ¡€ 9¢€¤€ €¡€¡€0€0€ €¡€|¢€•0€ €¡€0€ €!NCBI assigned secondary structure¢€0€0€ €¡€helix 1¢€¤€ €¡€¡€0€0€ €¡€¢€0€ €¡€helix 2¢€¤€ €¡€¡€0€0€ €¡€¢€$0€ €¡€helix 3¢€¤€ €¡€¡€0€0€ €¡€;¢€L0€ €¡€helix 4¢€¤€ €¡€¡€0€0€ €¡€W¢€_0€ €¡€helix 5¢€¤€ €¡€¡€0€0€ €¡€f¢€w0€ €¡€helix 6¢€¤€ €¡€¡€0€0€ €¡€}¢€•¤€0€0€ €¡€¢€0€ €QSingle-coordinate-per-atom model from PDB entry 2MM1 with a vector model attached¡€Resolution: 2.8¢€X-Ray Diffraction£€-APR 1 3 Typographical~JAN 15 93 Initial Entry£€0€ € ¡€ ¢€ ¤€0€0€ €¢€ € €0€ €æ¡€0€ €æ¡€0€ ¢€0€                                              !!!!!!!!!!!"""""""""####$$$$$$$$$$%%%%%%%&&&&&&&&&'''''''(((((((()))))))))*********+++++++++++,,,,,,,,-----------.........../////////000000000011111111222222222333333444444444555555556666666667777777788888888899999::::::;;;;;;;;;<<<<<<<<========>>>>>>>>>?????????@@@@@@@@@@AAAABBBBBCCCCCCCDDDDDDDEEEEEEEEFFFFFFFGGGGGHHHHHHHHIIIIJJJJKKKKKKKKLLLLLLLLMMMMMMMMMNNNNNNNNNOOOOOOOOOPPPPQQQQQQQQQQRRRRRRRRRRSSSSSSSSSTTTTTUUUUUUUUUVVVVVVVVWWWWWWWWWXXXXXXXYYYYYYYYZZZZZ[[[[[[[[[\\\\\\]]]]]]]]]]^^^^^_______`````````aaaaaaaaaabbbbbbbbbccccccccdddddddeeeeeeefffffffffgggggggggggghhhhhhhhiiiiiiiiijjjjjjjjjjjkkkkkkkkllllllmmmmmmmmmnnnnnooooooooppppppppqqqqqqqqqrrrrrrrsssssssstttttttttuuuuuuvvvvvvvvvwwwwwwwwwwxxxxxxxyyyyzzzzzzzz{{{{{{{{{{{||||}}}}}~~~~~~~~€€€€€€€€€‚‚‚‚‚ƒƒƒƒƒƒƒƒ„„„„„„„„………………………†††††‡‡‡‡‡‡‡‡ˆˆˆˆˆˆˆˆˆ‰‰‰‰‰‰‰‰ŠŠŠŠŠŠŠŠŠŠŠ‹‹‹‹‹‹‹‹‹‹‹ŒŒŒŒŒŒŒŒŒŽŽŽŽŽŽŽŽ‘‘‘‘‘‘‘‘’’’’’’’’’’’’“““““““““”””””””””••••••••––––———————————˜˜˜˜˜˜˜˜˜™™™™™£€0€                                                                                                                                                                                                                                                                                                               !"#$%&'()*+¢€0€ €è¡€0€éHí¡òåó÷ö(û]úÖöÐþœþrøÆ°ÿ2×&n*• ‹m XpÌ^üø ÈÍ"Ç& ã¿ _¬ ÏÉ& 'à 2 óÆþÝûªü÷÷ÿýñôãúÐöNµ&ÍDyACúXö£#a&¾!š[",|™:;l>¹ì ’zž!­#ÿ%Ü$*2+—-¸#½&#ì&K%‚ '¨w9Í;aŠ…i5ƈ,êF Ë"z&Ì&Ñ*“/*-©02(4Ü5ê8¸=>)ž'v%x%±#Xá%î#!m%×$qGÅø#Ý*…/:02L3û.>.¡*r+45¹2c: %¥! ›÷M¿Ð‹" !Õ%I#¦#¶"Ô#ó*2.",H,¦*i(A#ï$&0*°.‚,1û0 “!Ä#%m$³'S,5-=*Ÿ1'ì*$&%û.¯2ê7Â8§:Ï"W8ÚX=¡7a “PÌ ð¦#9"ð"(›(-R- #y#9y"º%Ù*M.½3¤4‡7£í½v®œ ××àÓOEG ]e œ!‰ l ì')&+î)h*í¦-œø î  Ç ¬  Z[¬ ñ߯ÿ\ýŸùfüüàýöYþÏþáúàÊY68ßÿcþ A b ^SýøÁô~ñüöJøöúÓÿ!ø©óŽï¢ðìQðZî`éÚå|àtôãööÀùµúìúpûçø¬ûøoùÖôôøêüïmí‡êÍîÈùý›Züý9ú‘ýýþúuÓbÚ ˜  ™ Ÿ wÆ ­¥Dÿ Ê -Ìüö°öÊñM b1q0î I-ëú=ÊËð³´û!‡%Ž$à#)Eaý)£-Ë-©+o2Ü1¼/ü0½4z4j3€6ñ:9Å<›7¡;_7¨8=>ÚClE›Dú4(04-#,Š,¨.€+ &<,ª+l(ƒ+l)v'N$?!Œ™0;3_3Ø4{8’8;;t@ Aø3d3¾.¦/6G*$%#û#¨ §¤#U"PÀè#m(ß*.&÷/)”…P‡ § uAëœ?ëÉ«Ö!a%S*d/?1ˆù– ~ —ÊÑ  L  +. ǰ„üòùÇü •ÎÏë— 1 §ÈsæJýiþWý.ùdq‚•Œ¡G9t #¥Ãø3Ó‡8ˆþ/üB´þƒûÝö¦÷®õ³ó7ûüŒýgúh6Uý3êbýÇüÒúËöórò:ò ð(óYñCîŒêòìëWøû<ûû7Ý G´úàúãööFû¬ýƒøzÇòí?íDéBèpçÂãCÞÙ\ñÕòÑíèìqõiù¦úOúÁù)êýæXáÝ”àmÛnÜ0Ü»ÚÜtàÂÚøáÖÞhÜ.ÝذÙâuã#ç@ß÷æŸâ>ÔÏSÎ-Í ÊyȽÇíÄŒÊtÎo;Ñ“ÐÎÊÖ]ÚkÚ'Üßùá8ÞÇܯߨ ×®ÓUÔuØÇÞ´ÕEàüÎÉîÊ„ÈêÅäÁ¼A·²ÍÌZÍТÏVÏbÐÝÎ=ÕÙg×jØ?Ý âáå¥ä°ÔÌÒYÎ1Î%ÐÊúÆÐÉǙȾÿ¾ ¿…»i̵ÏXÒpÓÒú×ÐÔŠ×ÉÔ˜ÖÜHßòÞ…äöâ{æjÏýÌÉeÊeÈ Åþ¹Å3´¿Ã»°É›ËÊЧÐÑÌsÇ3ÇËÊEÔÚÙ÷Ù§Ü€Þ7Ý÷ÞyÝxÞ+݈Ö ÔòÙÒÜ-Ò‹Ì•Ê{ËÈ¿Û/ßÅÞ„Ü0ãfäzèxètàSß²ãç'áfäþã,áOãøéìLà2Úšá¬éëîÀó÷ªîsó õÙòhô`ñhôzöúññŒñÿññøðõñhñWóôLørûlïìEç—ïëøü±‹ûbù©õŠðòöŸ–«M âdY)®8£pçZ ^ l¡[8¥{%–~!\.Ê “j_ çÕ9â¿Ü©7Q Ôlß%„)î¹",K%ÿ*Ð-Í2š)S-e+'—-U*ý-¿/³4*p,9*,É.$386™)¿% ¼&¤3]7Ü<©@Ç7+22Ü/7í;ô@ByGL>>@?I@ÎAÎD <`<7>6Ê< @6@¿B ?7;Î9@:W57k4tF‘H¨H=DÀN#O@IüK~K§GaHxB§>`9Z5H=ìCdF]D~:A67¾9O4£.Ò+x,ø&1'š$T7i8Ô4‰0&6 2K-8)º4-(M&!G)c+Ë0)‹)U'U$8 !+‹&K#á['ç%Ë)&û. [ÿï hè³ M?µ ¶ M‡7lCk xð:·ö ¿Î+æþŒù³¹`Ø AÁþ—ü5÷¦ˆÿcþ;úö9eè ß³ú°öîñ™íàøù³ù©üéõøñŒíééåîÖêçëßí*ë_è#ãaïöï‡ì4òoëÜò îÉêõèàã¨ßÝìÖð+óŠøù*ö™ü·ãÃßFÚÌÖÀàÞ½à/ܽÛ}ÛÈ×õÕÜÑڌڊ×qÝÙ¶Ù Õ6Ñ)Þ_ÞNßÝòÖŸÓ}ÍÐÊoÕî̸ÇwÃË¿tÇ^ɦÅKÂ'Á¼åÄŠÅØÊÁñÄøÄŒ¿½¼ƒÉ›Í·ÍÅÑèÑÄÕüÕÞÙ¸¿O»#µú±Ì»ã¿®¿ÓÃÏÄ»¶§±ó°6«s³1µ°·M¸C·Ç³Ã²²ƒ²•´Õµuºb°’²È³·m¶²»ÇÀIÆÁzÃ^ÃG¾ÜDz¾ÕÇ¿ÃMÈLË»ÉíÇçÑkÔ”Ó¨ÒÛÓóÊãÉVËHÍ"ÊýïYë¦ð½ôRï_î{ì›ëóíVîòí6éØãêàÅÝ™á•òòsôíõóôõþøyú:ñó·õÆôcñˆøéõŸö|í´îìÁëÇìbìÃê˜ïeðSïqò*ö33A°³ó݃û7ý³¢€0€C§E(D©@ÁH¢H¯HI%MOOÝQ)TòFBEkJ±MŽ@çAÏK†PP­UOQTmX0TÏL=LTNlQÓLQMÉSuVIÝD[@ =¥>ÌUì[p^ùcR\ó[gWO]ßW [b(\lc†`´]_¸_êd]_)[C\˜VK[ƒ[t`cèV R±Q¦M-_˜cYhñlfbfu\úiÎoOq<uÐo¸nIo„qDm¬o.pžukTj4emüm nksviçg±kµuOz+ƒEyP}ž÷}Ö…‚zœ„|%€Ñ~Òƒ–†H‹ƒ„u‡Šâq|Òwt‰qH„º†“Œ%Ž‚„ä~Œó’ •óšc’Cj}‘½“û—šëŸ“a™›[˜þ•Ö™h›üŸšùšÆ˜¯š¯—¿˜œ ™ºšŸˆ¡ïžë §‡¨£8ž`›…•ë“å“{Ž5õŠXŒsŠq’…pŠ…²‘¾’“ê’1–õ˜R“t’Ýœíœû¡å£¥ ׋†ë„Œ‰BƒŒH‡p…†"‚aƒí€†È…§‚5‰ Šú‰è‡ßsÇ–qó‹Š„bƒ3Œµ’³Š]•·€í{.y³wx6sztv‡uKrVw<{Jzo|Sy,|·|ZwS€¨gƒÂX€v‰¿Œ‰—s‹}’eí€x~8xdva„ļ‡x„—vptoPlr(qÜvèyko’jDeÆhôa¼c•x!|Ò}EÊ|ŠyÓuNxøy¢|x~Öt³pm!oáhy|g„ñ‡‡|Å|Ëw?‡Œ·“”œ’Η@’FŒŽa”’б‰õŽËjþŽd”í—‹Œ†‡%ƒB†H–Òœ$Ÿ¿žœ9™“Лtݘ“`¤'¨0«å­¥ªÝ© ¤ù«Š¬½°2®5±d±™­œ®È± ±b®¹³ó©B§m¥k£„£ž¥Q©i¢å«¤‹¨¨¥ö¤C¥ï¢`¥ Ü¡ä¢Ê£¯ªË¬Óªº«‡²âµ;µ·á·š¹Y§þ¥Î¡‡žf¤w¨i­î§ ¢žCš“•»¡+£· ÌŸm™Áœî™Áš=ß›=šÏ–]•Äš›ZÀ‹Ö‰OŠh›Ð ¤Ñ§‰¡fž›È¼¥C©|¨È¬P©’ª¯¨k¨Õ¦j¤¢l£œ¥øœ››1”Á“¡º¢ƒ¨I©XŸº™í–ž“ç•«±±\´/¸˜´² ´`´°f±i²O¹>¹Ø¸[¶Ç¿\Á¿Ô¿W¿p¸×·Ï±þ°`¹ø¹”¹`¹|®÷©%§{¤L§7¡n tŸ¶©Þ©9ª[§–­4¬F¯'«û¬ï®±°{¬ªæµ(º>¾ ÂwÄW©Õ¥¾  ž¥ ¡T¢#œ…žš™Ÿš7š)–8žÁ 4ŸœI¦¡X¡›S™þ£©¨ß {˜s’ÓÌŒ½‚Š‘øÓŽMË”Œ0‹†û”Y– ”>“hœ¾ž6Ÿl“zŠñ‰~‘ˆ‚Íô-{Gx6y¾„jƒñ…yƒZ‰5Ф…w„`‚N}2yvÚ{Ë€avsTwàsÍsÑo¸t,q@q!k·xyÚx9xÏ©… ƒþˆˆvetnŠkÔv‹|Y}—~h}Slwfãcâ`€dÛhwhGb¬b\dªa(cÐb2g„jfoTsŒl9hÛjLcùfZbn·sMtÅx2r§mHj j¬eÀeûr¬sµy‰{–qakôkÐohæ|Cà„Ɉ¾ƒo‚×… ƒm†-ƒsƒF‡©‹_‡~Ñ|c~k€Ovpužrdp2~‹€y„ð„˜‚cß~R€¼‰hŽŒ³‰’!›ŠFЬˆø†‡–…½†iƒ „Ã~#€Qyrƒù‡4ŠQ‰¬‹Š¥‰’Š­­‘<Ž˜¢”·‘ÿŠ †îƒVÜ„Yˆ’ŒS‰£Œü‚ ~Ùÿr}…nˆö“œ‹œŽ-‡½¢”X“x“û˜£šåžX¢¦0’(‘0Œ)‹ Ú”½š “þœk˜ÛˆëƒÐ€m´„—…i†ÊŒ~q~<zÛus[|Á‚Ÿy‚„Mr lQjVl®j­n×sèf3cÛa^_Á`"`¿Zq`ï^žb…a<]£Z\•\ `¹g^lmop¹q)lßv4mmv×ros'júkvgkhSkpp¤u4c4_;a+`hY¾W¨SwT‡NýdfHi~h9iQf `£hd]‰el`m‚q\nýrv&zþtc8j=g˜efefcDdIca ed^^¨^x\£YÚ^ i~mäoBp½rånâp†m nîq£u{s vWhd$e%e ^]pZ`WÚfgKkílhNg}fËc‹j pt¶s„u`y¥~Nzôpšo?ll¥l1n¢j›q$h®ehgï`å]ÑXÌV(WGloŽs8s¼rïpçuÚy¾wÃz²}â—‚àˆjŠºs pjÓg>qDvn{w‹~º|¯jdÌab]æe¥k`nb__€`R_¾a¨bm`‹`0gùiÕjdju_©]ÍXOW+a—`Ía^õ`§]ð^ÕUOšLMÂGC<DBFÊ=¯B‹CH†I@}EFZG;L‚QîRÉUlUóPP_L¤MhP,R5OXMsO2HôE\GmF7J€LØQuPàNeU’ZcY)[ù]r`óg`iãTïR­P¨Q]NúKªGiM°N8LqQLQDHÚDGB&>.9SUSZ6\¸^2]ó]$_y\a^x` d d¦i¥WKS¡TúUýNJD›CbAîTÝUáZ«ZcW6WÓR¨Y+^ c×cdgl?pTl™tÝpúu(a_ç]^{\Ú`[]0[(VSDTXòU‘Y8Y8QoR²NoMÔRí\7_ócdb‰^ŒZÊ_:eØitfùi?jkomtšzhbK_3^_gYö]I\a8`Š[ VMeºj†k¤mo0ooŽnÂj|k-h+j-i–mžrœlXv*oØtÑxOcS_ŽaØaªZBVÆQ/NHËdf“j†k¸hsd>eRi§aCl?pnsq²u=vdy y0imfíh0gj]kŠfb_p@tüx(vV|”z§}ÏfÅb^_`4cƒfƒl<n oPY^UpV–R«[ Žd›1[‚ ü”$™›Þ˜ž“™¦¡~¢žÎ›«Ÿt‰°ŠÏ††‚Í„Á†§}a{‰ „_‚J…¦‰ä}7…=€k“ƒ’ —n› ˜·—Ì ù¤;©pª!¬ó_N±C4f+§»­÷±ì£€0€=â:^=(?á<>ÚDÒG>=G86†8/FáLƒNdKFNM’SAVeU®U [ë^Õ\åbÌU‡TŸONK[EäDãA¶B]B8>´@:«G^F±H®FªI©G HQB™DîA[?‘=-;Z:1L°ODK~JæTKWü\€aZàI E-AŠABüB^G&@z?I;£=¶;"9ž6`6™BCöDÇC§H:FLJWA5F}GSBAnJ·IËHãJ>:96ú3r5%4„/Ã8Ï6 9d75æ3H5€-Ñ1¾,ò)œ($³#ï>*@ó=Ð<Ó<[9J4#2@7ý<;_@ =ÿ1È,´-}**ß'¶(2I3›4œ5æ8:Ï=±B&;_4W5<0Ç1–4õ,h'(#‡ô%d ^¶$Ÿ!ÇRÑ%y#¿+8&Ry:j5/îŠóÖÐ fïìÛ §f¥ÍÄ!' –ì „é dþ/ùd_þ û÷üšØþ¯ýgù!$Íñ÷úç÷£› éúoõÐñí ö¬ùù³õpñˆíëwæØîìèë"î^ï@î=êåæÞóKô„øôýö™úÐóÈìÕê‡äÝá=îLíîsïåä ÞãÛÖsÞãâmâÂåwæèËéÜèÙsØëÔ¦Û Ù ÔƒÏãÊêÝ=ÝFÙ‚ÕýÚ“×½Õ…ØÛ[ÜñÚkàÀܨà€ÐÍÎÍ«ÍòÈúÊ´;Í[ÍJÒ3ÒHÌÜÐ[Ð|ÏiÑœÖgÛRÚ·ÛÊàÞ‡á¸Øß×üÔÛÕÕÕšÓà×ÒÓÑ0ÎѱÐuÊ0ÄôÂ:ľzÖÙ÷ÛéÝbÞ‚ܨØêØöØ¢ÛÆÝsØÃÕ/àýåíæê‡êšï%ï ØïÔâÖµÓqÓ‚Î*ÍôÊ+ÛËÞÝÝ©ã­çÙìûðõºø_ø[Û¾ÛÕxÓÕßKäÌæöçËì ìßî÷Ò§Í,ÊÇÊ‹ËÈÆÂáÁ ÊvÇÁÉÌÇǵÌ÷ÐàÎëÕÓøÎBÐMÌGÊ×ÕÿÙäØ'ßAÊ_Æ7ÈkÈvÁ-¾yÀ3¼ ¼Ê€ÌËÒ©ÔáÊ$Ä“ÕÚ¶܉á*ÜááeÝ5åØÓÙ¥ÚŸÞ‚ÕÓ¬×ZÏÖÖ×Ü)ßiÒgÌÞȨÉÅÄ‚Ý á²æËê”áQ܃ÝéØ,æþë´ìàñëµêíäë=î›é é¹ë í?äþéâëðÞóhè?êoòúøšú2þÈúmü.È]_öˆöõ÷Çûò=òé÷ï.ôŸô¿úBü±ð+ï†êóÅü8? &÷iç 1:cÚ 5'”Ȥe©ýrýlû9ÿzüzÇÏ ¿½>wlмý‘5º­ÈKþ / •‚L» þ% Qž¥É Ë%N%è*_$Á('%Î!Q!Å#Õ(!$"q(J*Óþ7¹*f0 3F7Ž1C4Z5Ñ:H1Ø24¿8›,G*]+^$O355·;¯>X3ˆ.X,/^=¿C4F;K CóIƒHCFAºC¼F7EõFnCpBÚ?*Aë>­ED‰CsF×IŽK—QvSMXÔ?B>à?<B¦Bð?£AÒHzLOwNRªQì:ˆ7304f22ÿ.¶0(-™410—,T3²1ò,*“)L4Þ5`1Ö/u;1.Q(‘%/æ5«8¢6†=j'×"›=Æ#¯"ž ÷#Â Ë L´"?"¬ ^ ¥{*ç\¾u!r!ŒÜm ¨ 5ø \Ð &î  ó ­`¾ÿ/ D%J%ß*’ýEøìÖoþiúÌ÷hòúýìå}þ‡DTù6ö òRí¢ú£óæñ îFê}õ~øÈøcðíê^å}ñºó[ø ùüòíêºç|ã©îîó;òøw÷6úÎéHæëæ¡â€á…á¶ÜVÚáÕ—ë"ëºìlð[ð`ïðð¦ë¬èŽè¥í(îZã@áXããï±ôLò¾õÿ÷-õ/÷%í¥ë±ìøí×åØä߃ÚÖæì÷íÕó}ôYëxå—âEã_Ü×ÞÚÂÕv÷&üµþ¾=´XÇû ûéøñúú¡õmõ\öËóìô¿ñdôÓõ‘ìÇçÓè(âõãµÞmÞÓ÷úkÊÿû7ýxþýÿ ˆ˜L ¤ &ÿ ”kùÃõ¡ðJð2ìtý(ý^úÇ; µŽ½Ÿ oS  ]Î)["àô+ %@~ GŽüu÷ö óy © ÏJ ý9-Y·µ?ð#ô½€Ý Í  ðQœ’‹ ~‹kæ"™ô›´| %@$È&(­'‰)ú#Ú'ú$M"R!m&H&…gû 8*"/37Þ1†5L2¥5)7S8å5=-ž*'($%Â$Ö) (w#À,Œ,]*d)v)¿'Ù*Â(|(J/›2×3i4#8F;f9&?3]3Ø.Ð.~4„*Ý%ª$æ þ!i/ÿ%](O'Â)ÿ(.20ö-Ï+Ï6-R*~%k#‰)j$Å&³)ç#0A. nÝà#Ç%@&¤&,)Ô)ÿ/˜/þ2L(i)Û$þ%,L!ë#òúe ƒCªíÞQ¢œ!í ¶'ž+3+0¹k½ÌÍEí=T",Žì¿ _ € jw3™ b>AÏ8b!í&°)LÓÅÐ Í%U%).È ð ¤M  E 3Ž MÚg,+l >ÝVî  Ã›N¡¯ý=KýEþŽÁû4¶ú(ügûI÷òŸ°¬‰ÿ{°˜ òéeêaP)oþrøÆõ䬜‘÷ÇòÄïêJðêí_íî®ïë¹ë`èÉèå}å(ë)êåï7óHìè:çTâáë‹îòˆø úwùíÿ6þº jŠñЄ”} U áEÐ k´ ìæ  Ï FG º øùÂú²õÖò ôvõkì!ê<ù€ô%ñ]ô÷úëkôXö(ó´îéö¼ûH6¼.oüª Á£€ €0€ €è¡€0€GËE‘B­D?e< :;œ98T9‰57Z3"3,1›/W*Å4&3ô2Z2;¦E-IGh1354/5H88Ë9Ú< A‚CãA©G!8g7´6×69²:Ê6`6›5è6×9í=àAïD C4W3Â3?2P6º:37Ç<ù2ª2x2ú5[1ë.­21‘0Q.Â-Y.]*C((æ0¡20û0y3"5y8q4/.S-Y+ -;0Q.0\&z" Ù : §zø†ÐTâ[ Dô!¡# !) !É ± :!4)Ë25>"õ!!y %¬wº"K#Ÿ"Ø#Ç&3,‘4:=:*"#!!Ó"`Ì$·'º+—)I'‡(´)Ö)!.S0—1¹2å/M.…11°3Ì4D32Z4Ù4/3þ2‚3?3,5Ó0f+Ô)@(Y,¹,œ,Î*»(¾)@)@,ö0\/”24ã54Ù9ø=Ë>AŒ=@5ò6â62ª=EºJLJGË5ƒ5Ó7•8þ33·2(725f4Æ7Z6º869&7¾0û+¿'º#m*b&H)@%Æ'¯&Ý#‚!p.7Ü?IÓPONŽS3 Ï õ&Ê]ôþ=Ð &\(êNÐ]ZcWûfgÿ´äìE³Í‚<ˆ(úª žn|»V±6b»ÃŒ’ö‡  DTô…ª"s%9'$Ö'‡'¥&!y+0\2x4N2P8†@tC&Cb2å2‚5p60—0G.¸)q+G6ÿ8q:R<<4D3g1#1.,-©,A>bA<AÈBÌDÝJ#MLqA<C§GßI>Ú>R0P J‡FFdEëFCÚEX]¡^Øb¢b—f”iFiŒim\±[XVT_©deþg˜i<iV!QóOëO¹JÍC>ÚA(M±M0I˜JVO¯MOURCRD„@â@Aï?¿C>95«536º3g5 4Æ9&3 1`12m1.0f0f0o/¼0/Ï.….ô.J3,/Š4î0Q1`1i/÷2•4&9ã1K2(4a453;‡@$GI˜D„3¤2x2P3]0\0 .š/§/M,A&p0è2½1.ô¤ª\wÓ×q —Q!Ó)I*b18Ó¾ýnHî# ”Á¯$?+*Uë Ð'¥.…3…5Ó5˜7Ÿ64BéL6O’O¯SÊTK7 788þ2ª0\. .¸-³+49í=^?HAùA‚D¡K'LgN ?è@t@œ@UEAAcCvB†AFŸK OØT‘SçBhDC±BÌD\B·Fx@AæCDÊE‡C¼AÈAEAÒHFnFïHNJ¦HG¤GéGÕFúE-B IƒGrFÈHÙG5I˜KÑLJH/LÁMJ¹J8T\&b `™bÊGßF•EÎDçFúIƒFPD\BIAnI3N*N¡OKNÔQ]@Ø@¹A–D\?µA?z@UBÖ>”:=à=I:ƒ9‰86;Î@BE›IoD=866j5«5)8Á:;‡;-99:Ý492x.J+R9>BÌB·Cã+ç(Œ'¥'t!˜2×ã%‰#•%$†""¥#‚'â(Ç(Ç)+)!.S'Í(–(F'Í%+Ô4D<æC“F•(ù)(ï&˜- 1°2(2Z3ô6B7Ç9Å){,,Ä.Ë/M3T3·3Ö- /¼. -Ñ68>žEAD¶L!-(+¿+„+o+R-n+¿-(-- 1+((w+$^Ü)E&˜')S)é$0*0)S'â(<.­8,:ÝAY5ƒ(<( %v$^)+"U!˜"}"jè<b¶#w$g%&#Z#2 %#$'_*C( ( 2½=¸E›EºFÑ&[$®#Ò$g"Í ä l!ñ!É$þ# ð›ÕJ){,_+e+„5 ?ÉFŸE‘N +\+„*²+„*ø-Y*b)+(O&è)à+e,×./²'ì'º*¨(ï"ˆ!x­’!-F1845f0\/b,á5f9v: ;¦7Ñ6ÿ4ž3­;‡BD\EÎ1õ.-Y-ð,‡*C&Ó(©%¨%€&Ê+Ý+¢,A+=.Ë043"6-/Ú550¡0>@iHbPxFŸ,¦)é*- %(1%“#Ò$q$é'}(Ü&z*M!Ó!Q#d!ñ&À'‡'Í( &*'¥&¢&'j*Å/D64v&3&[%9"¥+ò6ˆ9í8®#Œ pe#½)£+—,0—œ 0Àøÿ!$¤&3 /ßj•(d-P,á.š8^BSH/N*IÝ,ì-©-x,‡+*(1&¢(+—,$-¾-È)™&3'Ä%»'ì't&/:0y1~0y0Ž6s;Uk;ÿ2 3…3r44D9=:H6Ä44ž2c.+;öB?C÷DG0É-¾+o*Ú1K3 3é*“*b)6)Ë)¸&Ó(ï)Ë,¯-©'Í&¢/b2å5 2ï5¶2³2È4&:ÔAùIfI):ü9ž6B:¢355>1#(nRMYœ_x^$VTV®T‘VÕWÅhUry­}<qpsúwLzíu±~]„“‰l‰l‚Ç€y~®ŽC“a˜Cš#šœœ+kb” d¢¢¢»¡þ¢0žŽžñŸKŸˆ¡ £Þ¤`¢í£¿ ( Ÿ~žÓœ·!Ââsx©ùÎ×ÈãÚ0À„é+^>z<ö¯yÉý ” ä­ Wß,!ƒ ä!ñ Ù#< 1GßÐØhs<Vߤ€0€ €è¡€0€èèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèèè‰÷0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€¡€¢€0€ €0€ €B@¡€‹ð8¢€Õ²0£€çr¡€0€ €B@¡€ ˜¢€"o£€:í¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€¢€$¡€¢€0€ €0€ €B@¡€['ð¢€Çið£€ÿV…H¡€0€ €B@¡€›&À¢€e_p£€tÖ(¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€;¢€L¡€¢€0€ €0€ €B@¡€Ò`P¢€â飀Üeà¡€0€ €B@¡€kƒp¢€É2 £€Éž ¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€W¢€_¡€¢€0€ €0€ €B@¡€ÿ2ÌÀ¢€ÿh£€Áh¡€0€ €B@¡€ÿGn¢€û£€sÈ ¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€f¢€w¡€¢€0€ €0€ €B@¡€º€¢€¶3°£€lV`¡€0€ €B@¡€²å¸¢€‹O8£€½»(¢€0€ €¡€0€ €¡€0€¤€helix¢€ €¡€0€ €¡€¡€0€0€ €¡€}¢€•¡€¢€0€ €0€ €B@¡€þÄ?ø¢€¢X£€ ¡€0€ €B@¡€º÷H¢€£€ģآ€0€ €¡€¡€1€ €0€ €1€®€0€ €2MM1¡€A¢€¡€0€ €Ç¡€¢€«€ h`c¡€1€´€0€ €¡€0€ €Ç¡€¢€¡€Oxygen Transport¢€0€[X-Ray Crystal Structure Of A Recombinant Human Myoglobin Mutant At 2.8 Angstroms Resolution£€0€,Mol_id: 1; Organism_scientific: Homo Sapiens¶€0€¢€0€ € Homo sapiens¡€human£€1€0€ €taxon¡€ €%†¤€1€man¥€0€ € €0€ €Homo¡€sapiens£€šEukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae; Homo¤€¥€¦€PRI¢€0€ € ¡€ ¢€™¦€¡€A™GLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDRFKHLKSEDEMKASEDLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISEAIIQVLQSKHPGDFGADAQGAMNKALELFRKDMASNYKELGFQG